"AKR1C1" Related Products

Recombinant Human AKR1C1, His-tagged

Cat.No. : AKR1C1-27156TH
Product Overview : Recombinant full length Human AKR1C1 (amino acids 1-323) with N terminal His tag; 343aa, 38.9kDa.
Description : This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.
Protein length : 323 amino acids
Conjugation : HIS
Molecular Weight : 38.900kDa inclusive of tags
Source : E. coli
Tissue specificity : Expressed in all tissues tested including liver, prostate, testis, adrenal gland, brain, uterus, mammary gland and keratinocytes. Highest levels found in liver, mammary gland and brain.
Biological activity : Specific activity: approximately 0.15 - 0.2 units/mg.Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1 micromole NADPH per minute at 25°C. Specific activity was expressed as units/mg protein.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 20% Glycerol
Storage : Please see Notes section
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMDSKYQCVKLNDGHFMPVLG FGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQ VGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALE RSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFD TVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKP GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALG SHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQ LQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN RNVRYLTLDIFAGPPNYPFSDEY
Sequence Similarities : Belongs to the aldo/keto reductase family.
Gene Name : AKR1C1 aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase) [ Homo sapiens ]
Official Symbol : AKR1C1
Synonyms : AKR1C1; aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase); DDH1; aldo-keto reductase family 1 member C1; DD1; DDH; HAKRC; MBAB;
Gene ID : 1645
mRNA Refseq : NM_001353
Protein Refseq : NP_001344
MIM : 600449
Uniprot ID : Q04828
Chromosome Location : 10p15-p14
Pathway : Metabolism of xenobiotics by cytochrome P450, organism-specific biosystem; Metabolism of xenobiotics by cytochrome P450, conserved biosystem; Steroid hormone biosynthesis, organism-specific biosystem; Steroid hormone biosynthesis, conserved biosystem;
Function : 17-alpha,20-alpha-dihydroxypregn-4-en-3-one dehydrogenase activity; aldo-keto reductase (NADP) activity; androsterone dehydrogenase (B-specific) activity; bile acid binding; carboxylic acid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.