Recombinant Human AKR1C1, His-tagged

• Cat.No.: AKR1C1-27156TH
• Product Overview: Recombinant full length Human AKR1C1 (amino acids 1-323) with N terminal His tag; 343aa, 38.9kDa.

Specification

• Description: This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reaction of progesterone to the inactive form 20-alpha-hydroxy-progesterone. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14.
• Protein length: 323 amino acids
• Conjugation: HIS
• Molecular Weight: 38.900kDa inclusive of tags
• Source: E. coli
• Tissue specificity: Expressed in all tissues tested including liver, prostate, testis, adrenal gland, brain, uterus, mammary gland and keratinocytes. Highest levels found in liver, mammary gland and brain.
• Biological activity: Specific activity: approximately 0.15 - 0.2 units/mg.Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1 micromole NADPH per minute at 25°C. Specific activity was expressed as units/mg protein.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 20% Glycerol
• Storage: Please see Notes section
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMDSKYQCVKLNDGHFMPVLG FGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQ VGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALE RSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFD TVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKP GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALG SHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQ LQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN RNVRYLTLDIFAGPPNYPFSDEY
• Sequence Similarities: Belongs to the aldo/keto reductase family.

Gene Information

• Gene Name: AKR1C1 aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase) [ Homo sapiens ]
• Official Symbol: AKR1C1
• Synonyms: AKR1C1; aldo-keto reductase family 1, member C1 (dihydrodiol dehydrogenase 1; 20-alpha (3-alpha)-hydroxysteroid dehydrogenase); DDH1; aldo-keto reductase family 1 member C1; DD1; DDH; HAKRC; MBAB
• Gene ID: 1645
• mRNA Refseq: NM_001353
• Protein Refseq: NP_001344
• MIM: 600449
• Uniprot ID: Q04828
• Chromosome Location: 10p15-p14
• Pathway: Metabolism of xenobiotics by cytochrome P450, organism-specific biosystem; Metabolism of xenobiotics by cytochrome P450, conserved biosystem; Steroid hormone biosynthesis, organism-specific biosystem; Steroid hormone biosynthesis, conserved biosystem
• Function: 17-alpha,20-alpha-dihydroxypregn-4-en-3-one dehydrogenase activity; aldo-keto reductase (NADP) activity; androsterone dehydrogenase (B-specific) activity; bile acid binding; carboxylic acid binding