Recombinant Human BMI1 BMI1-27486TH

Recombinant Human BMI1

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human BMI1

Recombinant Human BMI1

BMI1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : BMI1-27486TH
Product Overview : Recombinant full length protein of Human Bmi1 with proprietary tag; predicted MW 61.60 kDa, inclusive of tag.
Description : BMI1 polycomb ring finger oncogene, also known as BMI1, is a protein which in humans is encoded by the BMI1 gene.
Protein length : 326 amino acids
Molecular Weight : 61.600kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCK TCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVY KLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVND KRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPL KDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR DGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQ SPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKASVNGS SATSSG
Sequence Similarities : Contains 1 RING-type zinc finger.
Gene Name : BMI1 BMI1 polycomb ring finger oncogene [ Homo sapiens ]
Official Symbol : BMI1
Synonyms : BMI1; BMI1 polycomb ring finger oncogene; B lymphoma Mo MLV insertion region 1 homolog (mouse) , PCGF4, polycomb group ring finger 4; polycomb complex protein BMI-1; RNF51;
Gene ID : 648
mRNA Refseq : NM_005180
Protein Refseq : NP_005171
MIM : 164831
Uniprot ID : P35226
Chromosome Location : 10p13
Pathway : Senescence and Autophagy, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem;
Function : RING-like zinc finger domain binding; chromatin binding; metal ion binding; protein binding; ubiquitin-protein ligase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy