"BMI1" Related Products

Expand
Expand

Recombinant Human BMI1

Cat.No. : BMI1-27486TH
Product Overview : Recombinant full length protein of Human Bmi1 with proprietary tag; predicted MW 61.60 kDa, inclusive of tag.
Description : BMI1 polycomb ring finger oncogene, also known as BMI1, is a protein which in humans is encoded by the BMI1 gene.
Protein length : 326 amino acids
Molecular Weight : 61.600kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCK TCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVY KLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADE DKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVND KRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPL KDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQR DGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQ SPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKASVNGS SATSSG
Sequence Similarities : Contains 1 RING-type zinc finger.
Gene Name : BMI1 BMI1 polycomb ring finger oncogene [ Homo sapiens ]
Official Symbol : BMI1
Synonyms : BMI1; BMI1 polycomb ring finger oncogene; B lymphoma Mo MLV insertion region 1 homolog (mouse) , PCGF4, polycomb group ring finger 4; polycomb complex protein BMI-1; RNF51;
Gene ID : 648
mRNA Refseq : NM_005180
Protein Refseq : NP_005171
MIM : 164831
Uniprot ID : P35226
Chromosome Location : 10p13
Pathway : Senescence and Autophagy, organism-specific biosystem; Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem;
Function : RING-like zinc finger domain binding; chromatin binding; metal ion binding; protein binding; ubiquitin-protein ligase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.