Recombinant Human BMI1 Protein(1-250aa), GST-tagged
Cat.No. : | BMI1-495H |
Product Overview : | Recombinant Human BMI1 Protein(1-250aa)(P35226), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-250aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 56.4kDa |
AA Sequence : | MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | BMI1 BMI1 polycomb ring finger oncogene [ Homo sapiens ] |
Official Symbol | BMI1 |
Synonyms | BMI1; BMI1 polycomb ring finger oncogene; B lymphoma Mo MLV insertion region 1 homolog (mouse) , PCGF4, polycomb group ring finger 4; polycomb complex protein BMI-1; RNF51; flvi-2/bmi-1; ring finger protein 51; polycomb group protein Bmi1; polycomb group RING finger protein 4; B lymphoma Mo-MLV insertion region 1 homolog; murine leukemia viral (bmi-1) oncogene homolog; PCGF4; FLVI2/BMI1; MGC12685; |
Gene ID | 648 |
mRNA Refseq | NM_005180 |
Protein Refseq | NP_005171 |
MIM | 164831 |
UniProt ID | P35226 |
◆ Recombinant Proteins | ||
BMI1-771H | Recombinant Human BMI1 Protein, His tagged | +Inquiry |
BMI1-2733H | Recombinant Human BMI1 protein(101-170 aa), C-His-tagged | +Inquiry |
BMI1-37HF | Recombinant Full Length Human BMI1 Protein | +Inquiry |
BMI1-2427M | Recombinant Mouse BMI1 Protein | +Inquiry |
BMI1-27487H | Recombinant Human BMI1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMI1-8437HCL | Recombinant Human BMI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMI1 Products
Required fields are marked with *
My Review for All BMI1 Products
Required fields are marked with *