Recombinant Human BMI1 Protein, His tagged
| Cat.No. : | BMI1-771H |
| Product Overview : | Recombinant Human BMI1 Protein with His tag was expressed in E. coli. |
| Availability | June 12, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | This gene encodes a ring finger protein that is major component of the polycomb group complex 1 (PRC1). This complex functions through chromatin remodeling as an essential epigenetic repressor of multiple regulatory genes involved in embryonic development and self-renewal in somatic stem cells. This protein also plays a central role in DNA damage repair. This gene is an oncogene and aberrant expression is associated with numerous cancers and is associated with resistance to certain chemotherapies. A pseudogene of this gene is found on chromosome X. Read-through transcription also exists between this gene and the upstream COMM domain containing 3 (COMMD3) gene. |
| Molecular Mass : | The protein has a calculated MW of 39 kDa. |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.15 mg/mL by BCA |
| Storage Buffer : | Sterile PBS, pH 7.4 |
| Gene Name | BMI1 BMI1 polycomb ring finger oncogene [ Homo sapiens ] |
| Official Symbol | BMI1 |
| Synonyms | BMI1; BMI1 polycomb ring finger oncogene; B lymphoma Mo MLV insertion region 1 homolog (mouse), PCGF4, polycomb group ring finger 4; polycomb complex protein BMI-1; RNF51; flvi-2/bmi-1; ring finger protein 51; polycomb group protein Bmi1; polycomb group RING finger protein 4; B lymphoma Mo-MLV insertion region 1 homolog; murine leukemia viral (bmi-1) oncogene homolog; PCGF4; FLVI2/BMI1; MGC12685; |
| Gene ID | 648 |
| mRNA Refseq | NM_005180 |
| Protein Refseq | NP_005171 |
| MIM | 164831 |
| UniProt ID | P35226 |
| ◆ Recombinant Proteins | ||
| BMI1-27486TH | Recombinant Human BMI1 | +Inquiry |
| BMI1-495H | Recombinant Human BMI1 Protein(1-250aa), GST-tagged | +Inquiry |
| BMI1-2733H | Recombinant Human BMI1 protein(101-170 aa), C-His-tagged | +Inquiry |
| BMI1-350H | Recombinant Human BMI1 protein, His/MBP-tagged | +Inquiry |
| BMI1-427HFL | Active Recombinant Full Length Human BMI1 Protein, N-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BMI1-073HKCL | Human BMI1 Knockdown Cell Lysate | +Inquiry |
| BMI1-8437HCL | Recombinant Human BMI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMI1 Products
Required fields are marked with *
My Review for All BMI1 Products
Required fields are marked with *
