Recombinant Human BMI1 Protein, His tagged
Cat.No. : | BMI1-771H |
Product Overview : | Recombinant Human BMI1 Protein with His tag was expressed in E. coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene encodes a ring finger protein that is major component of the polycomb group complex 1 (PRC1). This complex functions through chromatin remodeling as an essential epigenetic repressor of multiple regulatory genes involved in embryonic development and self-renewal in somatic stem cells. This protein also plays a central role in DNA damage repair. This gene is an oncogene and aberrant expression is associated with numerous cancers and is associated with resistance to certain chemotherapies. A pseudogene of this gene is found on chromosome X. Read-through transcription also exists between this gene and the upstream COMM domain containing 3 (COMMD3) gene. |
Molecular Mass : | The protein has a calculated MW of 39 kDa. |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.15 mg/mL by BCA |
Storage Buffer : | Sterile PBS, pH 7.4 |
Gene Name | BMI1 BMI1 polycomb ring finger oncogene [ Homo sapiens ] |
Official Symbol | BMI1 |
Synonyms | BMI1; BMI1 polycomb ring finger oncogene; B lymphoma Mo MLV insertion region 1 homolog (mouse), PCGF4, polycomb group ring finger 4; polycomb complex protein BMI-1; RNF51; flvi-2/bmi-1; ring finger protein 51; polycomb group protein Bmi1; polycomb group RING finger protein 4; B lymphoma Mo-MLV insertion region 1 homolog; murine leukemia viral (bmi-1) oncogene homolog; PCGF4; FLVI2/BMI1; MGC12685; |
Gene ID | 648 |
mRNA Refseq | NM_005180 |
Protein Refseq | NP_005171 |
MIM | 164831 |
UniProt ID | P35226 |
◆ Recombinant Proteins | ||
BMI1-771H | Recombinant Human BMI1 Protein, His tagged | +Inquiry |
BMI1-1049M | Recombinant Mouse BMI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BMI1-135H | Recombinant Human BMI1 protein, Arginine-tagged | +Inquiry |
BMI1-316H | Recombinant Human BMI1 Protein, His-tagged | +Inquiry |
BMI1-27486TH | Recombinant Human BMI1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMI1-8437HCL | Recombinant Human BMI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMI1 Products
Required fields are marked with *
My Review for All BMI1 Products
Required fields are marked with *
0
Inquiry Basket