"BMI1" Related Products

Expand
Expand

Recombinant Human BMI1 protein, Arginine-tagged

Cat.No. : BMI1-135H
Product Overview : Recombinant human Bmi1 protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.
Source : E. coli
Species : Human
Tag : Arginine
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : HRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQ DIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDK EKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYR VRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPS GNHQSSFANRPRKSSVNGSSATSSGLEESGGGGSPGRRRRRRRRRRR
Purity : >90% by SDS-PAGE
Applications : 1. Protein transduction for human HSC cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name : BMI1 BMI1 polycomb ring finger oncogene [ Homo sapiens ]
Official Symbol : BMI1
Synonyms : BMI1; RNF51; flvi-2/bmi-1; ring finger protein 51; polycomb group protein Bmi1; polycomb group RING finger protein 4; PCGF4; FLVI2/BMI1; MGC12685;
Gene ID : 648
mRNA Refseq : NM_005180
Protein Refseq : NP_005171
MIM : 164831
UniProt ID : P35226
Chromosome Location : 10p13
Pathway : Senescence and Autophagy, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem;
Function : RING-like zinc finger domain binding; chromatin binding; metal ion binding; protein binding; ubiquitin-protein ligase activity; zinc ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.