Recombinant Human BMI1 protein, Arginine-tagged

Cat.No. : BMI1-135H
Product Overview : Recombinant human Bmi1 protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : HRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQ DIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDK EKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYR VRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPS GNHQSSFANRPRKSSVNGSSATSSGLEESGGGGSPGRRRRRRRRRRR
Purity : >90% by SDS-PAGE
Applications : 1. Protein transduction for human HSC cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production.
Storage : Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name BMI1 BMI1 polycomb ring finger oncogene [ Homo sapiens ]
Official Symbol BMI1
Synonyms BMI1; RNF51; flvi-2/bmi-1; ring finger protein 51; polycomb group protein Bmi1; polycomb group RING finger protein 4; PCGF4; FLVI2/BMI1; MGC12685;
Gene ID 648
mRNA Refseq NM_005180
Protein Refseq NP_005171
MIM 164831
UniProt ID P35226
Chromosome Location 10p13
Pathway Senescence and Autophagy, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem;
Function RING-like zinc finger domain binding; chromatin binding; metal ion binding; protein binding; ubiquitin-protein ligase activity; zinc ion binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMI1 Products

Required fields are marked with *

My Review for All BMI1 Products

Required fields are marked with *

0
cart-icon