Recombinant Human BMI1 protein, Arginine-tagged
Cat.No. : | BMI1-135H |
Product Overview : | Recombinant human Bmi1 protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | HRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQ DIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDK EKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYR VRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPS GNHQSSFANRPRKSSVNGSSATSSGLEESGGGGSPGRRRRRRRRRRR |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein transduction for human HSC cell differentiation.2. Active recombinant protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay.4. Immunogen for specific antibody production. |
Storage : | Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | BMI1 BMI1 polycomb ring finger oncogene [ Homo sapiens ] |
Official Symbol | BMI1 |
Synonyms | BMI1; RNF51; flvi-2/bmi-1; ring finger protein 51; polycomb group protein Bmi1; polycomb group RING finger protein 4; PCGF4; FLVI2/BMI1; MGC12685; |
Gene ID | 648 |
mRNA Refseq | NM_005180 |
Protein Refseq | NP_005171 |
MIM | 164831 |
UniProt ID | P35226 |
Chromosome Location | 10p13 |
Pathway | Senescence and Autophagy, organism-specific biosystem; Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem; Validated targets of C-MYC transcriptional activation, organism-specific biosystem; |
Function | RING-like zinc finger domain binding; chromatin binding; metal ion binding; protein binding; ubiquitin-protein ligase activity; zinc ion binding; zinc ion binding; |
◆ Recombinant Proteins | ||
BMI1-1049M | Recombinant Mouse BMI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BMI1-135H | Recombinant Human BMI1 protein, Arginine-tagged | +Inquiry |
BMI1-37HF | Recombinant Full Length Human BMI1 Protein | +Inquiry |
BMI1-10246H | Recombinant Human BMI1, GST-tagged | +Inquiry |
BMI1-350H | Recombinant Human BMI1 protein, His/MBP-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMI1-8437HCL | Recombinant Human BMI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMI1 Products
Required fields are marked with *
My Review for All BMI1 Products
Required fields are marked with *
0
Inquiry Basket