Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human C4BPB

Cat.No. : C4BPB-26312TH
Product Overview : Recombinant full length Human C4 binding protein with N terminal proprietary tag; predicted MWt: 53.35 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Alternative splicing gives rise to multiple transcript variants.
Protein length : 252 amino acids
Molecular Weight : 53.350kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MFFWCACCLMVAWRVSASDEHCPELPPVDNSIFVAKEV EGQILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTECRLG HCPDPVLVNGEFSSSGPVNVSDKITFMCNDHYILKGSNRS QCLEDHTWAPPFPICKSRDCDPPGNPVHGYFEGNNFTLGS TISYYCEDRYYLVGVQEQQCVDGEWSSALPVCKLIQEAPK PECEKALLAFQESKNLCEAMENFMQQLKESGMTMEELKYS LELKKAELKAKLL
Sequence Similarities : Contains 3 Sushi (CCP/SCR) domains.
Gene Name : C4BPB complement component 4 binding protein, beta [ Homo sapiens ]
Official Symbol : C4BPB
Synonyms : C4BPB; complement component 4 binding protein, beta; C4BP, complement component 4 binding protein, beta; C4b-binding protein beta chain; C4b binding protein; beta chain; complement component 4 binding protein;
Gene ID : 725
mRNA Refseq : NM_000716
Protein Refseq : NP_000707
MIM : 120831
Uniprot ID : P20851
Chromosome Location : 1q32
Pathway : Complement and coagulation cascades, organism-specific biosystem; Complement and coagulation cascades, conserved biosystem; FOXA1 transcription factor network, organism-specific biosystem; Pertussis, organism-specific biosystem; Pertussis, conserved biosystem;

Products Types

◆ Recombinant Protein
C4BPB-0054H Recombinant Human C4BPB Protein, GST-Tagged +Inquiry
C4BPB-474H Recombinant Human C4BPB Protein, His (Fc)-Avi-tagged +Inquiry
C4BPB-137H Recombinant Human C4BPB Protein, MYC/DDK-tagged, C13 and N15-labeled +Inquiry
C4BPB-10533H Recombinant Human C4BPB, His-tagged +Inquiry
C4BPB-6970H Recombinant Human Complement Component 4 Binding Protein, Beta, His-tagged +Inquiry

See All C4BPB Recombinant Protein

◆ Native Protein
C4BPB-184H Native Human C4b-Binding Protein +Inquiry

See All C4BPB Native Protein

◆ Lysates
C4BPB-8036HCL Recombinant Human C4BPB 293 Cell Lysate +Inquiry

See All C4BPB Lysates

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All C4BPB Products

Required fields are marked with *

My Review for All C4BPB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends