"CCL25" Related Products

Expand
Expand
Expand

Native Human CCL25

Cat.No.: CCL25-31214TH
Product Overview: Human TECK.
Description: This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for dendritic cells, thymocytes, and activated macrophages but is inactive on peripheral blood lymphocytes and neutrophils. The product of this gene binds to chemokine receptor CCR9. Alternative splicing results in multiple transcript variants.
Source: E. coli
Tissue specificity: Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine.
Form: Lyophilised
Storage buffer: Preservative: NoneConstituents: 10mM Acetic acid
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: hTECK is a 14.2 kDa protein containing 127 amino acid residues:QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPK RHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNMQT FQAGPHAVKKLSSGNSKLSSSKFSNPISSSRKNVSLL ISANSGL
Sequence Similarities: Belongs to the intercrine beta (chemokine CC) family.
Gene Name: CCL25 chemokine (C-C motif) ligand 25 [ Homo sapiens ]
Official Symbol: CCL25
Synonyms: CCL25; chemokine (C-C motif) ligand 25; SCYA25, small inducible cytokine subfamily A (Cys Cys), member 25; C-C motif chemokine 25; Ck beta 15; Ckb15; TECK; TECKvar; thymus expressed chemokine;
Gene ID: 6370
mRNA Refseq: NM_001201359
Protein Refseq: NP_001188288
MIM: 602565
Uniprot ID: O15444
Chromosome Location: 19p13.2
Pathway: Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem;
Function: CCR10 chemokine receptor binding; chemokine activity; hormone activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.