Active Recombinant Human CCL25 Protein (127 aa)

Cat.No. : CCL25-054C
Product Overview : Recombinant Human CCL25 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 127
Description : CCL25 (thymus expressed chemokine) is a novel CC chemokine that is distantly related (approximately 20% amino acid sequence identity) to other CC chemokines. Mouse CCL25 cDNA has also been cloned and shown to encode a 144 aa protein that exhibits 49% aa sequence identity to human CCL25. The expresssion of human and mouse CCL25 was shown to be highly restricted to the thymus and small intestine. Although dendritic cells have been demonstrated to be the source of CCL25 production in the thymus, dendritic cells derived from bone marrow do not express CCL25.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Fully biologically active when compared to standard. Determined by its ability to chemoattract human monocytes using a concentration range of 1.0 -10.0 ng/mL, corresponding to a Specific Activity of >1 × 10^5 IU/mg.
Molecular Mass : 14.2 kDa, a single, non-glycosylated polypeptide chain containing 127 amino acids.
AA Sequence : QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNMQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSRKNVSLLISANSGL
Endotoxin : Less than 1 EU/μg of rHuTECK/CCL25 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2μm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CCL25 chemokine (C-C motif) ligand 25 [ Homo sapiens ]
Official Symbol CCL25
Synonyms CCL25; chemokine (C-C motif) ligand 25; SCYA25, small inducible cytokine subfamily A (Cys Cys), member 25; C-C motif chemokine 25; Ck beta 15; Ckb15; TECK; TECKvar; thymus expressed chemokine; Ck beta-15; chemokine TECK; thymus-expressed chemokine; small-inducible cytokine A25; small inducible cytokine subfamily A (Cys-Cys), member 25; SCYA25; MGC150327;
Gene ID 6370
mRNA Refseq NM_001201359
Protein Refseq NP_001188288
MIM 602565
UniProt ID O15444

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL25 Products

Required fields are marked with *

My Review for All CCL25 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon