Native Human CCL25 CCL25-31214TH

Native Human CCL25

PRODUCTS

Home / Products / Native Proteins / Native Human CCL25

Native Human CCL25

Online Inquiry

CCL25 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CCL25-31214TH Optional Service: Optional requirements on this protein
Product Overview : Human TECK.
Description : This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for dendritic cells, thymocytes, and activated macrophages but is inactive on peripheral blood lymphocytes and neutrophils. The product of this gene binds to chemokine receptor CCR9. Alternative splicing results in multiple transcript variants.
Source : E. coli
Tissue specificity : Specifically expressed by thymic dendritic cells. High levels in thymus and small intestine.
Form : Lyophilised
Storage buffer : Preservative: NoneConstituents: 10mM Acetic acid
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : hTECK is a 14.2 kDa protein containing 127 amino acid residues:QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPK RHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNMQT FQAGPHAVKKLSSGNSKLSSSKFSNPISSSRKNVSLL ISANSGL
Sequence Similarities : Belongs to the intercrine beta (chemokine CC) family.
Gene Name : CCL25 chemokine (C-C motif) ligand 25 [ Homo sapiens ]
Official Symbol : CCL25
Synonyms : CCL25; chemokine (C-C motif) ligand 25; SCYA25, small inducible cytokine subfamily A (Cys Cys), member 25; C-C motif chemokine 25; Ck beta 15; Ckb15; TECK; TECKvar; thymus expressed chemokine;
Gene ID : 6370
mRNA Refseq : NM_001201359
Protein Refseq : NP_001188288
MIM : 602565
Uniprot ID : O15444
Chromosome Location : 19p13.2
Pathway : Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem;
Function : CCR10 chemokine receptor binding; chemokine activity; hormone activity;
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry


  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2023 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy