"DCAF7" Related Products

Expand
Expand

Recombinant Human DCAF7, His-tagged

Cat.No.: DCAF7-30698TH
Product Overview: Recombinant fragment of Human WDR68 with an N terminal His tag; 298aa, 33.6kDa inclusive of tag.
Description: The WD-repeat protein is encoded by the DCAF7 protein, it is 53% identical to the petunia An11 protein and is conserved in worms and yeast, which do not produce anthocyanins.
Protein length: 277 amino acids
Conjugation: HIS
Molecular Weight: 33.600kDa
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 2.4% Urea
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWD
Sequence Similarities: Belongs to the WD repeat DCAF7 family.Contains 4 WD repeats.
Gene Name: DCAF7 DDB1 and CUL4 associated factor 7 [ Homo sapiens ]
Official Symbol: DCAF7
Synonyms: DCAF7; DDB1 and CUL4 associated factor 7; WD repeat domain 68 , WDR68; DDB1- and CUL4-associated factor 7; HAN11; human anthocyanin; seven WD repeat protein of the AN11 family 1; SWAN 1;
Gene ID: 10238
mRNA Refseq: NM_005828
Protein Refseq: NP_005819
MIM: 605973
Uniprot ID: P61962
Chromosome Location: 17q23.3
Pathway: TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.