"DCAF7" Related Products

Expand
Expand

Recombinant Human DCAF7 Protein, GST-tagged

Cat.No.: DCAF7-4565H
Product Overview: Human HAN11 full-length ORF ( AAH01264, 1 a.a. - 342 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes a protein with multiple WD40 repeats which facilitate protein-protein interactions and thereby enable the assembly of multiprotein complexes. This protein has been shown to function as a scaffold protein for protein complexes involved in kinase signaling. This highly conserved gene is present in eukaryotic plants, fungi, and animals. The ortholog of this gene was first identified in plants as a key regulator of anthocyanin biosynthesis and flower pigmentation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 63.14 kDa
AA Sequence: MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: DCAF7 DDB1 and CUL4 associated factor 7 [ Homo sapiens (human) ]
Official Symbol: DCAF7
Synonyms: DCAF7; DDB1 and CUL4 associated factor 7; AN11; HAN11; WDR68; SWAN-1; DDB1- and CUL4-associated factor 7; WD repeat-containing protein 68; WD repeat-containing protein An11 homolog; human anthocyanin; seven-WD-repeat protein of the AN11 family-1
Gene ID: 10238
mRNA Refseq: NM_005828
Protein Refseq: NP_005819
MIM: 605973
UniProt ID: P61962

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.