Recombinant Human DCAF7 protein, His-SUMO-tagged
| Cat.No. : | DCAF7-3761H |
| Product Overview : | Recombinant Human DCAF7 protein(P61962)(1-342aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-342aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 54.9 kDa |
| AA Sequence : | MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | DCAF7 DDB1 and CUL4 associated factor 7 [ Homo sapiens ] |
| Official Symbol | DCAF7 |
| Synonyms | DCAF7; DDB1 and CUL4 associated factor 7; WD repeat domain 68 , WDR68; DDB1- and CUL4-associated factor 7; HAN11; human anthocyanin; seven WD repeat protein of the AN11 family 1; SWAN 1; WD-repeat protein; WD repeat domain 68; WD repeat-containing protein 68; WD repeat-containing protein An11 homolog; seven-WD-repeat protein of the AN11 family-1; AN11; WDR68; SWAN-1; |
| Gene ID | 10238 |
| mRNA Refseq | NM_005828 |
| Protein Refseq | NP_005819 |
| MIM | 605973 |
| UniProt ID | P61962 |
| ◆ Recombinant Proteins | ||
| DCAF7-0583H | Recombinant Human DCAF7 Protein (S2-V342), His/Strep tagged | +Inquiry |
| DCAF7-30698TH | Recombinant Human DCAF7, His-tagged | +Inquiry |
| DCAF7-4210H | Recombinant Human DCAF7 protein, His-tagged | +Inquiry |
| DCAF7-4565H | Recombinant Human DCAF7 Protein, GST-tagged | +Inquiry |
| DCAF7-0582H | Recombinant Human DCAF7 Protein (S2-V342), Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DCAF7-7055HCL | Recombinant Human DCAF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCAF7 Products
Required fields are marked with *
My Review for All DCAF7 Products
Required fields are marked with *
