Recombinant Human DCAF7 protein, His-SUMO-tagged

Cat.No. : DCAF7-3761H
Product Overview : Recombinant Human DCAF7 protein(P61962)(1-342aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-342aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 54.9 kDa
AA Sequence : MSLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name DCAF7 DDB1 and CUL4 associated factor 7 [ Homo sapiens ]
Official Symbol DCAF7
Synonyms DCAF7; DDB1 and CUL4 associated factor 7; WD repeat domain 68 , WDR68; DDB1- and CUL4-associated factor 7; HAN11; human anthocyanin; seven WD repeat protein of the AN11 family 1; SWAN 1; WD-repeat protein; WD repeat domain 68; WD repeat-containing protein 68; WD repeat-containing protein An11 homolog; seven-WD-repeat protein of the AN11 family-1; AN11; WDR68; SWAN-1;
Gene ID 10238
mRNA Refseq NM_005828
Protein Refseq NP_005819
MIM 605973
UniProt ID P61962

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DCAF7 Products

Required fields are marked with *

My Review for All DCAF7 Products

Required fields are marked with *

0
cart-icon