Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at BIO-Europe Spring|March 18–20, 2024|Booth #34

Recombinant Human EFNA3

Cat.No. : EFNA3-28626TH
Product Overview : Recombinant full length Human Ephrin A3 with N terminal proprietary tag; Predicted MWt 51.92 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin.
Protein length : 238 amino acids
Molecular Weight : 51.920kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in brain, skeletal muscle, spleen, thymus, prostate, testis, ovary, small intestine, and peripheral blood leukocytes.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSS NQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPG GGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPI KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLR MKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEG ENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
Sequence Similarities : Belongs to the ephrin family.
Gene Name : EFNA3 ephrin-A3 [ Homo sapiens ]
Official Symbol : EFNA3
Synonyms : EFNA3; ephrin-A3; EPLG3; Ehk1 L; LERK3;
Gene ID : 1944
mRNA Refseq : NM_004952
Protein Refseq : NP_004943
MIM : 601381
Uniprot ID : P52797
Chromosome Location : 1q21-q22
Pathway : Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; EPHA forward signaling, organism-specific biosystem;
Function : ephrin receptor binding; transmembrane-ephrin receptor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All EFNA3 Products

Required fields are marked with *

My Review for All EFNA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends