Recombinant Human EFNA3

Cat.No. : EFNA3-28626TH
Product Overview : Recombinant full length Human Ephrin A3 with N terminal proprietary tag; Predicted MWt 51.92 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 238 amino acids
Description : This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin.
Molecular Weight : 51.920kDa inclusive of tags
Tissue specificity : Expressed in brain, skeletal muscle, spleen, thymus, prostate, testis, ovary, small intestine, and peripheral blood leukocytes.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSS NQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPG GGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPI KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLR MKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEG ENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
Sequence Similarities : Belongs to the ephrin family.
Gene Name EFNA3 ephrin-A3 [ Homo sapiens ]
Official Symbol EFNA3
Synonyms EFNA3; ephrin-A3; EPLG3; Ehk1 L; LERK3;
Gene ID 1944
mRNA Refseq NM_004952
Protein Refseq NP_004943
MIM 601381
Uniprot ID P52797
Chromosome Location 1q21-q22
Pathway Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; EPHA forward signaling, organism-specific biosystem;
Function ephrin receptor binding; transmembrane-ephrin receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFNA3 Products

Required fields are marked with *

My Review for All EFNA3 Products

Required fields are marked with *

0
cart-icon