Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at Attend ADLM 2024 | July 28 - August 1, 2024

Recombinant Full Length Human EFNA3 Protein

Cat.No. : EFNA3-140HF
Product Overview : Recombinant full length Human Ephrin A3 with N terminal proprietary tag; Predicted MWt 51.92 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 51.920kDa inclusive of tags
Protein Length : 238 amino acids
AA Sequence : MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSS NQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPG GGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPI KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLR MKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEG ENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : EFNA3 ephrin-A3 [ Homo sapiens ]
Official Symbol : EFNA3
Synonyms : EFNA3; ephrin-A3; EPLG3; Ehk1 L; LERK3
Gene ID : 1944
mRNA Refseq : NM_004952
Protein Refseq : NP_004943
MIM : 601381
UniProt ID : P52797

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EFNA3 Products

Required fields are marked with *

My Review for All EFNA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /
  • Service lnquiry:

Stay Updated on the Latest Bioscience Trends