"FGF1" Related Products

Native Human FGF1

Cat.No.: FGF1-26203TH
Product Overview: Human FGF1.
Description: The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described.
Source: E. coli
Form: Lyophilised
Storage buffer: Preservative: NoneConstituents: 5mM Sodium phosphate, 100mM Sodium chloride, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: Recombinant Human FGF1 is a 15.8 kDa protein containing 140 amino acid residues:MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLA MDT DGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Sequence Similarities: Belongs to the heparin-binding growth factors family.
Gene Name: FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens ]
Official Symbol: FGF1
Synonyms: FGF1; fibroblast growth factor 1 (acidic); FGFA; heparin-binding growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1;
Gene ID: 2246
mRNA Refseq: NM_000800
Protein Refseq: NP_000791
MIM: 131220
Uniprot ID: P05230
Chromosome Location: 5q31.3-q33.2
Pathway: Downstream signaling of activated FGFR, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR1 ligand binding and activation, organism-specific biosystem; FGFR1b ligand binding and activation, organism-specific biosystem;
Function: S100 alpha binding; fibroblast growth factor receptor binding; growth factor activity; heparin binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.