Native Human FGF1
| Cat.No. : | FGF1-26203TH |
| Product Overview : | Human FGF1. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. |
| Form : | Lyophilised |
| Storage buffer : | Preservative: NoneConstituents: 5mM Sodium phosphate, 100mM Sodium chloride, pH 8.0 |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | Recombinant Human FGF1 is a 15.8 kDa protein containing 140 amino acid residues:MFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLA MDT DGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Sequence Similarities : | Belongs to the heparin-binding growth factors family. |
| Gene Name | FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens ] |
| Official Symbol | FGF1 |
| Synonyms | FGF1; fibroblast growth factor 1 (acidic); FGFA; heparin-binding growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; |
| Gene ID | 2246 |
| mRNA Refseq | NM_000800 |
| Protein Refseq | NP_000791 |
| MIM | 131220 |
| Uniprot ID | P05230 |
| Chromosome Location | 5q31.3-q33.2 |
| Pathway | Downstream signaling of activated FGFR, organism-specific biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR1 ligand binding and activation, organism-specific biosystem; FGFR1b ligand binding and activation, organism-specific biosystem; |
| Function | S100 alpha binding; fibroblast growth factor receptor binding; growth factor activity; heparin binding; protein binding; |
| ◆ Recombinant Proteins | ||
| Fgf1-5666M | Recombinant Mouse Fgf1 Protein (Phe16-Asp155), C-His tagged | +Inquiry |
| FGF1-629S | Recombinant Sheep FGF1 protein, His & T7-tagged | +Inquiry |
| Fgf1-565M | Active Recombinant Mouse Fibroblast Growth Factor 1 | +Inquiry |
| FGF1-159C | Active Recombinant Canine FGF1 protein | +Inquiry |
| FGF1-244H | Recombinant Human FGF1, StrepII-tagged | +Inquiry |
| ◆ Native Proteins | ||
| FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
| FGF1-26203TH | Native Human FGF1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF1-6252HCL | Recombinant Human FGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF1 Products
Required fields are marked with *
My Review for All FGF1 Products
Required fields are marked with *
