Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Native Human IGF2

Cat.No. : IGF2-29116TH
Product Overview : Human IGF-2.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5 region overlaps the INS gene and the 3 region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Form : Liquid
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : Human IGF-2 is a 7.5 kDa protein containing 67 amino acid residues:AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEEC CFRSCDLALLETYCATPAKSE
Sequence Similarities : Belongs to the insulin family.
Gene Name : IGF2 insulin-like growth factor 2 (somatomedin A) [ Homo sapiens ]
Official Symbol : IGF2
Synonyms : IGF2; insulin-like growth factor 2 (somatomedin A); C11orf43, chromosome 11 open reading frame 43; insulin-like growth factor II; FLJ44734;
Gene ID : 3481
mRNA Refseq : NM_000612
Protein Refseq : NP_000603
Uniprot ID : P01344
Chromosome Location : 11p15.5
Pathway : Apoptosis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem;
Function : growth factor activity; hormone activity; insulin receptor binding; insulin-like growth factor receptor binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends