"IGF2" Related Products


Native Human IGF2

Cat.No. : IGF2-29116TH
Product Overview : Human IGF-2.
Description : This gene encodes a member of the insulin family of polypeptide growth factors, which are involved in development and growth. It is an imprinted gene, expressed only from the paternal allele, and epigenetic changes at this locus are associated with Wilms tumour, Beckwith-Wiedemann syndrome, rhabdomyosarcoma, and Silver-Russell syndrome. A read-through INS-IGF2 gene exists, whose 5 region overlaps the INS gene and the 3 region overlaps this gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Form : Liquid
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : Human IGF-2 is a 7.5 kDa protein containing 67 amino acid residues:AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEEC CFRSCDLALLETYCATPAKSE
Sequence Similarities : Belongs to the insulin family.
Gene Name : IGF2 insulin-like growth factor 2 (somatomedin A) [ Homo sapiens ]
Official Symbol : IGF2
Synonyms : IGF2; insulin-like growth factor 2 (somatomedin A); C11orf43, chromosome 11 open reading frame 43; insulin-like growth factor II; FLJ44734;
Gene ID : 3481
mRNA Refseq : NM_000612
Protein Refseq : NP_000603
Uniprot ID : P01344
Chromosome Location : 11p15.5
Pathway : Apoptosis, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem;
Function : growth factor activity; hormone activity; insulin receptor binding; insulin-like growth factor receptor binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.