Recombinant Human LDHB, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human LDHB, His-tagged

Recombinant Human LDHB, His-tagged

LDHB Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : LDHB-26865TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-334 of Human lactate dehydrogenase B with N terminal His tag; 354 amino acids, 36.6kDa.
Description : This gene encodes an enzyme which catalyzes the reversible conversion of lactate and pyruvate, and NAD and NADH, in the glycolytic pathway. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on the X chromosome and on chromosome. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Protein length : 334 amino acids
Conjugation : HIS
Molecular Weight : 36.600kDa inclusive of tags
Source : E. coli
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHH SSGLVPRGSHMATLKEKLIAPVAEEEATVP NNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
Sequence Similarities : Belongs to the LDH/MDH superfamily. LDH family.
Gene Name : LDHB lactate dehydrogenase B [ Homo sapiens ]
Official Symbol : LDHB
Synonyms : LDHB; lactate dehydrogenase B; L-lactate dehydrogenase B chain;
Gene ID : 3945
mRNA Refseq : NM_001174097
Protein Refseq : NP_001167568
MIM : 150100
Uniprot ID : P07195
Chromosome Location : 12p12.2-p12.1
Pathway : Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Glycolysis / Gluconeogenesis, organism-specific biosystem; Glycolysis / Gluconeogenesis, conserved biosystem; Glycolysis and Gluconeogenesis, organism-specific biosystem;
Function : L-lactate dehydrogenase activity; NAD binding; identical protein binding; oxidoreductase activity;
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry


  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2022 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy