"NUDT21" Related Products

Expand

Recombinant Human NUDT21, His-tagged

Cat.No.: NUDT21-27532TH
Product Overview: Recombinant full length Human NUDT21 with an N terminal His tag; 247aa, 28.3kDa inclusive of tag.
Description: The protein encoded by this gene is one subunit of a cleavage factor required for 3 RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3 end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.
Protein length: 227 amino acids
Conjugation: HIS
Molecular Weight: 28.300kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Sequence Similarities: Belongs to the Nudix hydrolase family. CPSF5 subfamily.Contains 1 nudix hydrolase domain.
Gene Name: NUDT21 nudix (nucleoside diphosphate linked moiety X)-type motif 21 [ Homo sapiens ]
Official Symbol: NUDT21
Synonyms: NUDT21; nudix (nucleoside diphosphate linked moiety X)-type motif 21; cleavage and polyadenylation specific factor 5, 25 kD subunit , cleavage and polyadenylation specific factor 5, 25 kDa , CPSF5; cleavage and polyadenylation specificity factor subunit
Gene ID: 11051
mRNA Refseq: NM_007006
Protein Refseq: NP_008937
MIM: 604978
Uniprot ID: O43809
Chromosome Location: 16q12.2
Pathway: Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Processing of Capped Intronless Pre-mRNA, organism-specific biosystem;
Function: AU-rich element binding; contributes_to RNA binding; histone deacetylase binding; hydrolase activity; mRNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.