Recombinant Human NUDT21 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : NUDT21-5940H
Product Overview : NUDT21 MS Standard C13 and N15-labeled recombinant protein (NP_008937) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.
Molecular Mass : 26.2 kDa
AA Sequence : MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name NUDT21 nudix hydrolase 21 [ Homo sapiens (human) ]
Official Symbol NUDT21
Synonyms NUDT21; nudix (nucleoside diphosphate linked moiety X)-type motif 21; cleavage and polyadenylation specific factor 5, 25 kD subunit, cleavage and polyadenylation specific factor 5, 25 kDa, CPSF5; cleavage and polyadenylation specificity factor subunit 5; CFIM25; nudix motif 21; CPSF 25 kDa subunit; pre-mRNA cleavage factor Im (25kD); pre-mRNA cleavage factor Im, 25kD subunit; pre-mRNA cleavage factor Im 25 kDa subunit; nucleoside diphosphate-linked moiety X motif 21; cleavage and polyadenylation specific factor 5, 25 kDa; cleavage and polyadenylation specific factor 5, 25 kD subunit; cleavage and polyadenylation specificity factor 25 kDa subunit; CPSF5; DKFZp686H1588;
Gene ID 11051
mRNA Refseq NM_007006
Protein Refseq NP_008937
MIM 604978
UniProt ID O43809

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUDT21 Products

Required fields are marked with *

My Review for All NUDT21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon