Recombinant Human NUDT21 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | NUDT21-5940H |
| Product Overview : | NUDT21 MS Standard C13 and N15-labeled recombinant protein (NP_008937) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. |
| Molecular Mass : | 26.2 kDa |
| AA Sequence : | MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | NUDT21 nudix hydrolase 21 [ Homo sapiens (human) ] |
| Official Symbol | NUDT21 |
| Synonyms | NUDT21; nudix (nucleoside diphosphate linked moiety X)-type motif 21; cleavage and polyadenylation specific factor 5, 25 kD subunit, cleavage and polyadenylation specific factor 5, 25 kDa, CPSF5; cleavage and polyadenylation specificity factor subunit 5; CFIM25; nudix motif 21; CPSF 25 kDa subunit; pre-mRNA cleavage factor Im (25kD); pre-mRNA cleavage factor Im, 25kD subunit; pre-mRNA cleavage factor Im 25 kDa subunit; nucleoside diphosphate-linked moiety X motif 21; cleavage and polyadenylation specific factor 5, 25 kDa; cleavage and polyadenylation specific factor 5, 25 kD subunit; cleavage and polyadenylation specificity factor 25 kDa subunit; CPSF5; DKFZp686H1588; |
| Gene ID | 11051 |
| mRNA Refseq | NM_007006 |
| Protein Refseq | NP_008937 |
| MIM | 604978 |
| UniProt ID | O43809 |
| ◆ Recombinant Proteins | ||
| NUDT21-5940H | Recombinant Human NUDT21 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| NUDT21-27532TH | Recombinant Human NUDT21, His-tagged | +Inquiry |
| NUDT21-5051C | Recombinant Chicken NUDT21 | +Inquiry |
| Nudt21-4540M | Recombinant Mouse Nudt21 Protein, Myc/DDK-tagged | +Inquiry |
| NUDT21-6256M | Recombinant Mouse NUDT21 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NUDT21-3646HCL | Recombinant Human NUDT21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUDT21 Products
Required fields are marked with *
My Review for All NUDT21 Products
Required fields are marked with *
