Recombinant Human NUDT21, His-tagged

Cat.No. : NUDT21-27532TH
Product Overview : Recombinant full length Human NUDT21 with an N terminal His tag; 247aa, 28.3kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 227 amino acids
Description : The protein encoded by this gene is one subunit of a cleavage factor required for 3 RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3 end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides.
Conjugation : HIS
Molecular Weight : 28.300kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Sequence Similarities : Belongs to the Nudix hydrolase family. CPSF5 subfamily.Contains 1 nudix hydrolase domain.
Gene Name NUDT21 nudix (nucleoside diphosphate linked moiety X)-type motif 21 [ Homo sapiens ]
Official Symbol NUDT21
Synonyms NUDT21; nudix (nucleoside diphosphate linked moiety X)-type motif 21; cleavage and polyadenylation specific factor 5, 25 kD subunit , cleavage and polyadenylation specific factor 5, 25 kDa , CPSF5; cleavage and polyadenylation specificity factor subunit
Gene ID 11051
mRNA Refseq NM_007006
Protein Refseq NP_008937
MIM 604978
Uniprot ID O43809
Chromosome Location 16q12.2
Pathway Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Processing of Capped Intronless Pre-mRNA, organism-specific biosystem;
Function AU-rich element binding; contributes_to RNA binding; histone deacetylase binding; hydrolase activity; mRNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NUDT21 Products

Required fields are marked with *

My Review for All NUDT21 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon