Recombinant Human NUDT21, His-tagged
Cat.No. : | NUDT21-27532TH |
Product Overview : | Recombinant full length Human NUDT21 with an N terminal His tag; 247aa, 28.3kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 227 amino acids |
Description : | The protein encoded by this gene is one subunit of a cleavage factor required for 3 RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3 end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. |
Conjugation : | HIS |
Molecular Weight : | 28.300kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN |
Sequence Similarities : | Belongs to the Nudix hydrolase family. CPSF5 subfamily.Contains 1 nudix hydrolase domain. |
Gene Name | NUDT21 nudix (nucleoside diphosphate linked moiety X)-type motif 21 [ Homo sapiens ] |
Official Symbol | NUDT21 |
Synonyms | NUDT21; nudix (nucleoside diphosphate linked moiety X)-type motif 21; cleavage and polyadenylation specific factor 5, 25 kD subunit , cleavage and polyadenylation specific factor 5, 25 kDa , CPSF5; cleavage and polyadenylation specificity factor subunit |
Gene ID | 11051 |
mRNA Refseq | NM_007006 |
Protein Refseq | NP_008937 |
MIM | 604978 |
Uniprot ID | O43809 |
Chromosome Location | 16q12.2 |
Pathway | Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Gene Expression, organism-specific biosystem; Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem; Processing of Capped Intronless Pre-mRNA, organism-specific biosystem; |
Function | AU-rich element binding; contributes_to RNA binding; histone deacetylase binding; hydrolase activity; mRNA binding; |
◆ Recombinant Proteins | ||
NUDT21-6256M | Recombinant Mouse NUDT21 Protein, His (Fc)-Avi-tagged | +Inquiry |
NUDT21-079H | Recombinant Full Length Human nudix hydrolase 21 Protein, His&Flag&StrepII tagged | +Inquiry |
NUDT21-960H | Recombinant Human NUDT21, His-tagged | +Inquiry |
NUDT21-5051C | Recombinant Chicken NUDT21 | +Inquiry |
NUDT21-2211HF | Recombinant Full Length Human NUDT21 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT21-3646HCL | Recombinant Human NUDT21 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NUDT21 Products
Required fields are marked with *
My Review for All NUDT21 Products
Required fields are marked with *
0
Inquiry Basket