GMP Recombinant Porcine CXCL11 Protein, His-Tagged

Cat.No. : CXCL11-01P
Product Overview : GMP Recombinant Porcine CXCL11 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Porcine
Source : E.coli
Tag : His
Description : CXCL11 has functional and structural relationship with CXCL9 and CXCL10. This CXC chemokine lacks a ELR (Glutamate-Leucine-Arginine) tripeptide motif.. Similar to CXCL9 and CXCL10, CXCL11 can specifically bind to the G protein-coupled receptor CXCR3 and involve in chemotaxis of immune cells and angiogenesis. Expression of both CXCR3 and CXCL11 by The Th1-associated cytokine IFNγ can express both CXCR3 and CXCL11 and create an amplification loop of cell-mediated immune response between Th1 cells
Form : Lyophilized
AA Sequence : FPMFKAGRCLCIGPGVKAVKVADIEKVSIIHPSNNCDKTEVIVTLKAHKGRRCLNPKSKQANVIMKKVERMNFLRYQNV with polyhistidine tag at the N-terminus
Endotoxin : <0.1 EU per 1 μg of the protein by the LAL method.
Purity : >98% as determined by SDS-PAGE. Ni-NTA chromatography
Notes : Please use within one month after protein reconstitution.
Storage : Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Storage Buffer : The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Gene Name CXCL11 C-X-C motif chemokine ligand 11 [ Sus scrofa (pig) ]
Official Symbol CXCL11
Gene ID 100169744
mRNA Refseq NM_001128491.1
Protein Refseq NP_001121963.1
UniProt ID B3GDY9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL11 Products

Required fields are marked with *

My Review for All CXCL11 Products

Required fields are marked with *

0
cart-icon
0
compare icon