Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Protein Length : |
73 |
Description : |
CXCL11 also known as I-TAC is belonging to the CXC chemokine family and shares 36 % and 37 % amino acid sequence homology with IP-10 and MIG, respectively. It is highly expressed in peripheral blood leukocytes, pancreas and liver. Expression of CXCL11 is strongly induced by IFN-γ and IFN-β, and weakly induced by IFN-α. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3, which with a higher affinity than do the other chemokines for this receptor, CXCL9 and CXCL10. Similar to CXCL10, CXCL11 has been shown to be a chemoattractant for IL-2-activated T-lymphocytes, but not for isolated T-cells, neutrophils or monocytes. |
Form : |
Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 100 mM NaCl. |
Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human IL-2 activated human T-lymphocytes is in a concentration range of 0.1-10 ng/ml. |
Molecular Mass : |
Approximately 8.3 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids. |
AA Sequence : |
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
Endotoxin : |
Less than 1 EU/µg of rHuI-TAC/CXCL11 as determined by LAL method. |
Purity : |
>97% by SDS-PAGE and HPLC analysis. |
Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |