Active Recombinant Human CXCL11 Protein (73 aa)

Cat.No. : CXCL11-174C
Product Overview : Recombinant human I-TAC/CXCL11 produced in HEK293 cells is a single non-glycosylated polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhI-TAC/CXCL11 has a molecular mass of 8.3 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Protein Length : 73
Description : Chemokine (C-X-C motif) ligand 11(CXCL11), also known as I-TAC and B-R1, is a small cytokine belonging to the CXC chemokine family that is also called Interferon-inducible T-cell alpha chemoattractant (I-TAC) and Interferon-gamma-inducible protein 9 (IP-9).This chemokine elicits its effects on target cells by interacting with chemokine receptor CXCR3 having a higher affinity than other ligands for this receptor such as CXCL9 and CXCL10. CXCL11 is chemotactic for activated T cells. The gene encoding CXCL11 has been mapped to chromosome 4. CXCL11 cDNA encodes a 94 amino acid residue precursor protein with a 21 amino acid residue putative signal sequence, which is cleaved to form the mature 73 amino acid residue protein. CXCL11 shares 36% and 37% amino acid sequence homology with IP-10 and MIG (two other known human non-ELR CXC chemokines), respectively. Mouse CXCL11 exhibits 68% sequence homology with human CXCL11.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : The EC50 value of human I-TAC/CXCL11 on Ca^2+ mobilization assay in CHO-K1/Ga15/hCXCR3 cells (human Ga15 and human CXCR3 stably expressed in CHO-K1 cells) is less than 0.5 μg/mL.
Molecular Mass : 8.3 kDa, observed by reducing SDS-PAGE.
AA Sequence : FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 98% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant humanI-TAC/CXCL11 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, humanCXCL11/I-TAC should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name CXCL11 chemokine (C-X-C motif) ligand 11 [ Homo sapiens ]
Official Symbol CXCL11
Synonyms CXCL11; chemokine (C-X-C motif) ligand 11; SCYB9B, SCYB11, small inducible cytokine subfamily B (Cys X Cys), member 11; C-X-C motif chemokine 11; b R1; H174; I TAC; IP 9; beta-R1; small inducible cytokine B11; small-inducible cytokine B11; interferon gamma-inducible protein 9; interferon-inducible T-cell alpha chemoattractant; small inducible cytokine subfamily B (Cys-X-Cys), member 11; small inducible cytokine subfamily B (Cys-X-Cys), member 9B; IP9; IP-9; b-R1; I-TAC; SCYB11; SCYB9B; MGC102770;
Gene ID 6373
mRNA Refseq NM_005409
Protein Refseq NP_005400
MIM 604852
UniProt ID O14625

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL11 Products

Required fields are marked with *

My Review for All CXCL11 Products

Required fields are marked with *

0
cart-icon