Active Recombinant Human CXCL11 Protein (73 aa)
Cat.No. : | CXCL11-174C |
Product Overview : | Recombinant human I-TAC/CXCL11 produced in HEK293 cells is a single non-glycosylated polypeptide chain containing 73 amino acids. A fully biologically active molecule, rhI-TAC/CXCL11 has a molecular mass of 8.3 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Protein Length : | 73 |
Description : | Chemokine (C-X-C motif) ligand 11(CXCL11), also known as I-TAC and B-R1, is a small cytokine belonging to the CXC chemokine family that is also called Interferon-inducible T-cell alpha chemoattractant (I-TAC) and Interferon-gamma-inducible protein 9 (IP-9).This chemokine elicits its effects on target cells by interacting with chemokine receptor CXCR3 having a higher affinity than other ligands for this receptor such as CXCL9 and CXCL10. CXCL11 is chemotactic for activated T cells. The gene encoding CXCL11 has been mapped to chromosome 4. CXCL11 cDNA encodes a 94 amino acid residue precursor protein with a 21 amino acid residue putative signal sequence, which is cleaved to form the mature 73 amino acid residue protein. CXCL11 shares 36% and 37% amino acid sequence homology with IP-10 and MIG (two other known human non-ELR CXC chemokines), respectively. Mouse CXCL11 exhibits 68% sequence homology with human CXCL11. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The EC50 value of human I-TAC/CXCL11 on Ca^2+ mobilization assay in CHO-K1/Ga15/hCXCR3 cells (human Ga15 and human CXCR3 stably expressed in CHO-K1 cells) is less than 0.5 μg/mL. |
Molecular Mass : | 8.3 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 98% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant humanI-TAC/CXCL11 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, humanCXCL11/I-TAC should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | CXCL11 chemokine (C-X-C motif) ligand 11 [ Homo sapiens ] |
Official Symbol | CXCL11 |
Synonyms | CXCL11; chemokine (C-X-C motif) ligand 11; SCYB9B, SCYB11, small inducible cytokine subfamily B (Cys X Cys), member 11; C-X-C motif chemokine 11; b R1; H174; I TAC; IP 9; beta-R1; small inducible cytokine B11; small-inducible cytokine B11; interferon gamma-inducible protein 9; interferon-inducible T-cell alpha chemoattractant; small inducible cytokine subfamily B (Cys-X-Cys), member 11; small inducible cytokine subfamily B (Cys-X-Cys), member 9B; IP9; IP-9; b-R1; I-TAC; SCYB11; SCYB9B; MGC102770; |
Gene ID | 6373 |
mRNA Refseq | NM_005409 |
Protein Refseq | NP_005400 |
MIM | 604852 |
UniProt ID | O14625 |
◆ Recombinant Proteins | ||
CXCL11-931R | Recombinant Rhesus Macaque CXCL11 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCL11-106H | Human CXCL11, Biotin-tagged | +Inquiry |
Cxcl11-253M | Active Recombinant Mouse Cxcl11 Protein (Phe22-Met110), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CXCL11-270H | Recombinant Human Chemokine (C-X-C Motif) Ligand 11, His-tagged | +Inquiry |
CXCL11-280H-AF647 | Active Recombinant Human CXCL11 protein, Tag Free, Alexa Fluor 647 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL11-7171HCL | Recombinant Human CXCL11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL11 Products
Required fields are marked with *
My Review for All CXCL11 Products
Required fields are marked with *
0
Inquiry Basket