Recombinant Active Human IL22 Protein, His-tagged(C-ter)
Cat.No. : | IL22-177H |
Product Overview : | Recombinant Active Human IL22 Protein with His tag (C-ter) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | This gene is a member of the IL10 family of cytokines that mediate cellular inflammatory responses. The encoded protein functions in antimicrobial defense at mucosal surfaces and in tissue repair. This protein also has pro-inflammatory properties and plays a role in in the pathogenesis of several intestinal diseases. The encoded protein is a crucial cytokine that regulates host immunity in infectious diseases, including COVID-19 (disease caused by SARS-CoV-2). |
Form : | Powder |
Bio-activity : | Determined by its ability to induce proliferation in A549 cells. The ED50 for this effect is < 0.5 ng/mL. |
AA Sequence : | MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
Endotoxin : | Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : | > 98% (by SDS-PAGE) |
Applications : | SDS-PAGE |
Notes : | For laboratory research only, not for drug, diagnostic or other use. |
Storage : | Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : | PBS (pH 8.0) |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |
Gene Name | IL22 interleukin 22 [ Homo sapiens ] |
Official Symbol | IL22 |
Synonyms | IL22; interleukin 22; interleukin-22; IL 10 related T cell derived inducible factor; IL 21; IL 22; IL D110; IL TIF; ILTIF; MGC79382; MGC79384; TIFa; TIFIL 23; zcyto18; cytokine Zcyto18; IL-10-related T-cell-derived inducible factor; IL-10-related T-cell-derived-inducible factor; IL-21; IL-22; IL-TIF; IL-D110; TIFIL-23; |
Gene ID | 50616 |
mRNA Refseq | NM_020525 |
Protein Refseq | NP_065386 |
MIM | 605330 |
UniProt ID | Q9GZX6 |
◆ Recombinant Proteins | ||
Il22-01M | Active Recombinant Mouse Il22 Protein, His-Tagged | +Inquiry |
IL22-098I | Active Recombinant Human IL22 Protein (146 aa) | +Inquiry |
IL22-600M | Active Recombinant Mouse IL22, MIgG2a Fc-tagged, mutant | +Inquiry |
IL22-60Z | Recombinant Zebrafish IL22 Protein, His-tagged | +Inquiry |
Il22-3513M | Recombinant Mouse Il22 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL22-5232HCL | Recombinant Human IL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL22 Products
Required fields are marked with *
My Review for All IL22 Products
Required fields are marked with *
0
Inquiry Basket