Recombinant Zebrafish IL22 Protein, His-tagged
| Cat.No. : | IL22-60Z |
| Product Overview : | Recombinant Zebrafish IL22 Protein, fused to His-tag, was expressed in E. coli. |
| Availability | December 12, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Zebrafish |
| Source : | E.coli |
| Tag : | His |
| Description : | Acts upstream of or within defense response to Gram-negative bacterium; immune response; and regulation of inflammatory response. Is expressed in several structures, including caudal fin; gill; heart; liver; and pleuroperitoneal region. Orthologous to human IL22 (interleukin 22). |
| Form : | Supplied as a 0.2 μm filtered solution in PBS, 1 mM DTT (pH8.0). |
| Molecular Mass : | ~25 kDa |
| AA Sequence : | MHHHHHHMGDYAKGEKTTTVTYRHDIKAPEPQDALQVSTSRNNGVHKRTDTRIHSSTCDMKCFTLIALLCSCFLSGCARPTPLDSSATWNDLAAMTDTARNEDDHETRLLPYFSHDMLQEEGSCCINARILKYYVNHVLESDEHTDMKYPMIRNVREGLHRVEQELQNHCKHDYSSHPLVKQFKRNYHASAIMDLAAARNKAIGETNTLYHYLFESCTPK |
| Purity : | >90% |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.13 mg/ml |
| Gene Name | il22 interleukin 22 [ Danio rerio (zebrafish) ] |
| Official Symbol | IL22 |
| Synonyms | TIFa; IL-21; IL-22; ILTIF; IL-TIF; IL-D110; zcyto18; TIFIL-23 |
| Gene ID | 553964 |
| mRNA Refseq | NM_001020792 |
| Protein Refseq | NP_001018628 |
| UniProt ID | Q5TLE4 |
| ◆ Recombinant Proteins | ||
| IL22-2066R | Recombinant Rhesus Macaque IL22 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Il22-146M | Active Recombinant Mouse Il22 Protein | +Inquiry |
| IL22-461H | Active Recombinant Human IL22 protein | +Inquiry |
| IL22-2301H | Recombinant Human IL22 Protein, His-tagged | +Inquiry |
| IL22-601M | Active Recombinant Mouse Interleukin 22, MIgG2a Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL22-5232HCL | Recombinant Human IL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL22 Products
Required fields are marked with *
My Review for All IL22 Products
Required fields are marked with *
