Recombinant Zebrafish IL22 Protein, His-tagged
Cat.No. : | IL22-60Z |
Product Overview : | Recombinant Zebrafish IL22 Protein, fused to His-tag, was expressed in E. coli. |
Availability | August 05, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zebrafish |
Source : | E.coli |
Tag : | His |
Description : | Acts upstream of or within defense response to Gram-negative bacterium; immune response; and regulation of inflammatory response. Is expressed in several structures, including caudal fin; gill; heart; liver; and pleuroperitoneal region. Orthologous to human IL22 (interleukin 22). |
Form : | Supplied as a 0.2 μm filtered solution in PBS, 1 mM DTT (pH8.0). |
Molecular Mass : | ~25 kDa |
AA Sequence : | MHHHHHHMGDYAKGEKTTTVTYRHDIKAPEPQDALQVSTSRNNGVHKRTDTRIHSSTCDMKCFTLIALLCSCFLSGCARPTPLDSSATWNDLAAMTDTARNEDDHETRLLPYFSHDMLQEEGSCCINARILKYYVNHVLESDEHTDMKYPMIRNVREGLHRVEQELQNHCKHDYSSHPLVKQFKRNYHASAIMDLAAARNKAIGETNTLYHYLFESCTPK |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.13 mg/ml |
Gene Name | il22 interleukin 22 [ Danio rerio (zebrafish) ] |
Official Symbol | IL22 |
Synonyms | TIFa; IL-21; IL-22; ILTIF; IL-TIF; IL-D110; zcyto18; TIFIL-23 |
Gene ID | 553964 |
mRNA Refseq | NM_001020792 |
Protein Refseq | NP_001018628 |
UniProt ID | Q5TLE4 |
◆ Recombinant Proteins | ||
Il22-359I | Active Recombinant Mouse Il22 Protein (147 aa) | +Inquiry |
IL22-2245R | Recombinant Rhesus monkey IL22 Protein, His-tagged | +Inquiry |
IL22-2066R | Recombinant Rhesus Macaque IL22 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL22-217H | Recombinant Human IL22 Protein, His-tagged | +Inquiry |
IL22-002H | Active Recombinant Human IL22 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL22-5232HCL | Recombinant Human IL22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL22 Products
Required fields are marked with *
My Review for All IL22 Products
Required fields are marked with *