Recombinant Zebrafish IL22 Protein, His-tagged

• Cat.No.: IL22-60Z
• Product Overview: Recombinant Zebrafish IL22 Protein, fused to His-tag, was expressed in E. coli.

Specification

• Species: Zebrafish
• Source: E.coli
• Tag: His
• Description: Acts upstream of or within defense response to Gram-negative bacterium; immune response; and regulation of inflammatory response. Is expressed in several structures, including caudal fin; gill; heart; liver; and pleuroperitoneal region. Orthologous to human IL22 (interleukin 22).
• Form: Supplied as a 0.2 μm filtered solution in PBS, 1 mM DTT (pH8.0).
• Molecular Mass: ~25 kDa
• AA Sequence: MHHHHHHMGDYAKGEKTTTVTYRHDIKAPEPQDALQVSTSRNNGVHKRTDTRIHSSTCDMKCFTLIALLCSCFLSGCARPTPLDSSATWNDLAAMTDTARNEDDHETRLLPYFSHDMLQEEGSCCINARILKYYVNHVLESDEHTDMKYPMIRNVREGLHRVEQELQNHCKHDYSSHPLVKQFKRNYHASAIMDLAAARNKAIGETNTLYHYLFESCTPK
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.13 mg/ml

Gene Information

• Gene Name: il22 interleukin 22 [ Danio rerio (zebrafish) ]
• Official Symbol: IL22
• Synonyms: TIFa; IL-21; IL-22; ILTIF; IL-TIF; IL-D110; zcyto18; TIFIL-23
• Gene ID: 553964
• mRNA Refseq: NM_001020792
• Protein Refseq: NP_001018628
• UniProt ID: Q5TLE4