Species : |
Mouse |
Source : |
E.coli |
Tag : |
His |
Description : |
This gene encodes a cytokine that acts as a growth and differentiation factor for both B cells and eosinophils. The encoded cytokine plays a major role in the regulation of eosinophil formation, maturation, recruitment and survival. The increased production of this cytokine may be related to pathogenesis of eosinophil-dependent inflammatory diseases. This cytokine functions by binding to its receptor, which is a heterodimer, whose beta subunit is shared with the receptors for interleukine 3 (IL3) and colony stimulating factor 2 (CSF2/GM-CSF). This gene is located on chromosome 5 within a cytokine gene cluster which includes interleukin 4 (IL4), interleukin 13 (IL13), and CSF2 . This gene, IL4, and IL13 may be regulated coordinately by long-range regulatory elements spread over 120 kilobases on chromosome 5q31. [provided by RefSeq, Jul 2013] |
Form : |
Powder |
Bio-activity : |
Determined by its ability to induce TF-1 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant mouse IL-5 is > 5 x 10^6 IU/mg. |
AA Sequence : |
MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG |
Endotoxin : |
Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test. |
Purity : |
> 98% (by SDS-PAGE) |
Applications : |
SDS-PAGE |
Notes : |
For laboratory research only, not for drug, diagnostic or other use. |
Storage : |
Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : |
PBS (pH 7.4) |
Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |