Active Recombinant Rat Il5 Protein

Species :	Rat
Source :	CHO
Description :	Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, mediates the activities of eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF). It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release.
Form :	Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity :	ED50 < 0.5 ng/mL, measured in a proliferation assay using TF-1 Cells.
Molecular Mass :	13~21 kDa, observed by reducing SDS-PAGE.
AA Sequence :	MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV
Endotoxin :	< 0.2 EU/μg, determined by LAL method.
Purity :	> 95% as analyzed by SDS-PAGE.
Storage :	Lyophilized recombinant Rat Interleukin-5 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Interleukin-5 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer :	Lyophilized after extensive dialysis against PBS.
Reconstitution :	Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Name	Il5 interleukin 5 [ Rattus norvegicus ]
Official Symbol	Il5
Synonyms	IL5; interleukin 5; interleukin-5; TRF; IL-5; BCGF-II; B-cell growth factor II; T-cell replacing factor; cytotoxic T-lymphocyte inducer; eosinophil differentiation factor; Interleukin 5 (colony-stimulating factor eosinophil); Interleukin 5 (colony-stimulating factor, eosinophil);
Gene ID	24497
mRNA Refseq	NM_021834
Protein Refseq	NP_068606
UniProt ID	Q9R2C9