Active Recombinant Rat Il5 Protein
Cat.No. : | Il5-238I |
Product Overview : | Recombinant Rat Il5 Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | CHO |
Description : | Interleukin-5 (IL-5), produced by mast cells, T cells and eosinophils, mediates the activities of eosinophil differentiating factor, B cell growth factor II and T cell-replacing factor (TRF). It can increase production and mobilization of eosinophils and CD34+ progenitors from the bone marrow. IL-5 plays an important role in inducing cell-mediated immunity against parasitic infections and certain tumors. IL-5 also promotes differentiation of basophils and primes them for histamine and leukotriene release. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.5 ng/mL, measured in a proliferation assay using TF-1 Cells. |
Molecular Mass : | 13~21 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Rat Interleukin-5 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Rat Interleukin-5 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Il5 interleukin 5 [ Rattus norvegicus ] |
Official Symbol | Il5 |
Synonyms | IL5; interleukin 5; interleukin-5; TRF; IL-5; BCGF-II; B-cell growth factor II; T-cell replacing factor; cytotoxic T-lymphocyte inducer; eosinophil differentiation factor; Interleukin 5 (colony-stimulating factor eosinophil); Interleukin 5 (colony-stimulating factor, eosinophil); |
Gene ID | 24497 |
mRNA Refseq | NM_021834 |
Protein Refseq | NP_068606 |
UniProt ID | Q9R2C9 |
◆ Recombinant Proteins | ||
Il5-97R | Recombinant Rat Interleukin 5 | +Inquiry |
IL5-169H | Active Recombinant Human IL5 Protein (Ile20-Ser134), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Il5-111M | Active Recombinant Mouse Il5 Protein | +Inquiry |
IL5-125H | Recombinant Human IL5 | +Inquiry |
IL5-5734H | Recombinant Human IL5 protein, hFc-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL5-496MCL | Recombinant Mouse IL5 cell lysate | +Inquiry |
IL5-456CCL | Recombinant Canine IL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il5 Products
Required fields are marked with *
My Review for All Il5 Products
Required fields are marked with *