Recombinant Campylobacter jejuni CdtB Protein, His tagged
| Cat.No. : | CdtB-01C |
| Product Overview : | Recombinant Campylobacter jejuni CdtB Protein wiht His tag was expressed in E.coli. |
| Availability | October 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Citation
- Download
| Species : | Campylobacter jejuni |
| Source : | E.coli |
| Tag : | His |
| Form : | Lyophilized from sterile 20mM Tris, 200mM NaCl, 2mM DTT, 5% Trehalose, 5% Mannitol |
| Molecular Mass : | 27 kDa |
| AASequence : | MNLENFNVGTWNLQGSSAATESKWSVSVRQLVSGANPLDILMIQEAGTLPRTATPTGRHVQQGGTPIDEYEWNLGTLSRPDRVFIYYSRVDVGANRVNLAIVSRMQAEEVIVLPPPTTVSRPIIGIRNGNDAFFNIHALANGGTDVGAIITAVDAHFANMPQVNWMIAGDFNRDPSTITSTVDRELANRIRVVFPTSATQASGGTLDYAITGNSNRQQTYTPPLLAAILMLASLRSHIVSDHFPVNFRKFAS |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution. Centrifuge the vial at 4 centigrade before opening to recover the entire contents. |
| Official Symbol | CdtB |
| Synonyms | CdtB |
No difference in serum levels of B‐cell activating receptor and antibodies against cytolethal distending toxin B and flagellin in post‐infectious irritable bowel syndrome and chronic fatigue syndrome after Giardia infection
Journal: JGH Open: An Open Access Journal of Gastroenterology and Hepatology PubMed ID: 35355666 Data: 2022/3/14
Authors: Kurt Hanevik, Christina Saghaug, Nina Langeland
Article Snippet:For anti‐CdtB and anti‐flagellin, the optical density (OD) values from an in‐house ELISA were recorded.For anti‐CdtB and anti‐flagellin, the optical density (OD) values from an in‐house ELISA were recorded.. ELISA plates were coated with antigens from Campylobacter jejuni CdtB (Creative BioMart, Shirley, NY, USA) at the concentration 1.2 × 10 ?3 mg/mL and FLA‐ST Ultrapure, purified flagellin from Salmonella typhimurium —TLR5 ligand at a concentration 2.5 × 10 ?4 mg/mL (InvivoGen, Toulouse, France) in boric acid buffer.. After washing and blocking with 2% bovine serum albumin and washing, wells were incubated with serum at 1:500 dilution.After washing and blocking with 2% bovine serum albumin and washing, wells were incubated with serum at 1:500 dilution.
Study of Antibodies to Cytolethal Distending Toxin B (CdtB) and Antibodies to Vinculin in Patients with Irritable Bowel Syndrome
Journal: F1000Research Data: 2021/10/15
Authors: Maysaa El Sayed Zaki, Dina Elhammady, Asmaa Osama Bakr Osman
Article Snippet:The ELISA was used to determine the anti-CdTB of C. jejuni using the recombinant C ampylobacter CdtB protein ( https://www.creativebiomart.net/description_436265_12.htm ).. The protein was used as antigens immobilized at the wells of the 96 microplates overnight at 4 C with a concentration of 1.2 μg/mL prepared in borate buffer saline to obtain PH 8.2.The protein was used as antigens immobilized at the wells of the 96 microplates overnight at 4 C with a concentration of 1.2 μg/mL prepared in borate buffer saline to obtain PH 8.2.
Circulating Anti-cytolethal Distending Toxin B and Anti-vinculin Antibodies as Biomarkers in Community and Healthcare Populations With Functional Dyspepsia and Irritable Bowel Syndrome
Journal: Clinical and Translational Gastroenterology PubMed ID: 31356481 Data: 2019/7/24
Authors: Nicholas J. Talley, Gerald Holtmann, Simon Keely
Article Snippet:Anti-CdtB and anti-vinculin were run on the complete set of serum samples (n = 791).Anti-CdtB and anti-vinculin were run on the complete set of serum samples (n = 791).. Enzyme-linked immunosorbent assays were performed using complete recombinant Campylobacter CdtB protein (Creative BioMart, Shirley, NY) and full-length human vinculin protein (Novoprotein, Short Hills, NJ) as antigens at a concentration of 1.2 μg/mL by Commonwealth laboratories ( ).. Antigens were immobilized overnight at 4 °C onto high-binding 96-well plates (Grenier Bio-One, Monroe, NC) in borate buffered saline (Medicago, Uppsala, Sweden) at a pH of 8.2.Antigens were immobilized overnight at 4 °C onto high-binding 96-well plates (Grenier Bio-One, Monroe, NC) in borate buffered saline (Medicago, Uppsala, Sweden) at a pH of 8.2.
Development and Validation of a Biomarker for Diarrhea-Predominant Irritable Bowel Syndrome in Human Subjects
Journal: PLoS ONE PubMed ID: 25970536 Data: 2015/5/13
Authors: Mark Pimentel, Walter Morales, Seungil Ro
Article Snippet:ELISAs were performed using complete recombinant Campylobacter CdtB protein (Creative BioMart, Shirley, NY) and full length human vinculin protein (Novoprotein, Short Hills, NJ) as antigens at a concentration of 1.2 μg/mL.. Antigens were immobilized overnight at 4°C onto high-binding 96-well plates (Grenier Bio-One, Monroe, NC) in Borate Buffered Saline (BBS) (Medicago, Uppsala, Sweden) at a pH of 8.2.Antigens were immobilized overnight at 4°C onto high-binding 96-well plates (Grenier Bio-One, Monroe, NC) in Borate Buffered Saline (BBS) (Medicago, Uppsala, Sweden) at a pH of 8.2.
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CdtB Products
Required fields are marked with *
My Review for All CdtB Products
Required fields are marked with *
