| Cat.No.: | CDTB-2179E |
| Product Overview: | Recombinant Escherichia coli CDTB Protein (19-269 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
| Description: | Part of the tripartite complex that is required for the CDT activity. CdtB exhibits a DNA-nicking endonuclease activity, and very probably causes DNA damage in intoxicated cells. This damage induces G2/M cell cycle arrest, chromatin fragmentation, cell distention and nucleus enlargement. |
| Source: | E. coli |
| Species: | E. coli |
| Tag : | His-SUMO-Myc |
| Form: | Tris-based buffer,50% glycerol |
| Molecular Mass: | 47.4 kDa |
| Protein length: | 19-269 aa |
| AA Sequence: | DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR |
| Purity: | > 90% as determined by SDS-PAGE. |
| Notes: | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage: | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration: | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name: | cdtB type III cytolethal distending toxin protein CdtB [ Escherichia coli Vir68 ] |
| Official Symbol: | CDTB |
| Synonyms: | cdtB; |
| Gene ID: | 8164729 |
| UniProt ID: | Q46669 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All CDTB Products
Download Datasheet