Recombinant Escherichia coli CDTB Protein (19-269 aa), His-SUMO-Myc-tagged
Cat.No. : | CDTB-2179E |
Product Overview : | Recombinant Escherichia coli CDTB Protein (19-269 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-SUMO tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 19-269 aa |
Description : | Part of the tripartite complex that is required for the CDT activity. CdtB exhibits a DNA-nicking endonuclease activity, and very probably causes DNA damage in intoxicated cells. This damage induces G2/M cell cycle arrest, chromatin fragmentation, cell distention and nucleus enlargement. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 47.4 kDa |
AA Sequence : | DLTDFRVATWNLQGASATTESKWNINVRQLISGENAVDILAVQEAGSPPSTAVDTGTLIPSPGIPVRELIWNLSTNSRPQQVYIYFSAVDALGGRVNLALVSNRRADEVFVLSPVRQGGRPLLGIRIGNDAFFTAHAIAMRNNDAPALVEEVYNFFRDSRDPVHQALNWMILGDFNREPADLEMNLTVPVRRASEIISPAAATQTSQRTLDYAVAGNSVAFRPSPLQAGIVYGARRTQISSDHFPVGVSRR |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | cdtB type III cytolethal distending toxin protein CdtB [ Escherichia coli Vir68 ] |
Official Symbol | CDTB |
Synonyms | cdtB; |
Gene ID | 8164729 |
UniProt ID | Q46669 |
◆ Recombinant Proteins | ||
CDTB-39C | Recombinant Campylobacter jejuni subsp CDTB Protein | +Inquiry |
CDTB-2179E | Recombinant Escherichia coli CDTB Protein (19-269 aa), His-SUMO-Myc-tagged | +Inquiry |
CdtB-01C | Recombinant Campylobacter jejuni CdtB, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDTB Products
Required fields are marked with *
My Review for All CDTB Products
Required fields are marked with *
0
Inquiry Basket