Recombinant Campylobacter jejuni subsp CDTB Protein

Cat.No. : CDTB-39C
Product Overview : Campylobacter jejuni subsp CDTB Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Campylobacter jejuni subsp
Source : E.coli
Description : cytolethal distending toxin B
Form : The purified protein was Lyophilized from sterile 20 mM Tris-HCl buffer (pH 8.0) containing 0.2 M NaCl, 2 mM DTT. 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
Molecular Mass : ~27.4kDa
AA Sequence : MNLENFNVGTWNLQGSSAATESKWSVSVRQLVSGANPLDILMIQEAGTLPRTATPTGRHVQQGGTPIDEYEWNLGTLSRPDRVFIYYSRVDVGANRVNLAIVSRMQAEEVIVLPPPTTVSRPIIGIRNGNDAFFNIHALANGGTDVGAIITAVDAHFANMPQVNWMIAGDFNRDPSTITSTVDRELANRIRVVFPTSATQASGGTLDYAITGNSNRQQTYTPPLLAAILMLASLRSHIVSDHFPVNFRKFAS
Purity : >90%
Storage : Short-term storage: Store at 2-8 centigrade. Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Concentration : 1.0 mg/Vial

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDTB Products

Required fields are marked with *

My Review for All CDTB Products

Required fields are marked with *

0
cart-icon
0
compare icon