Recombinant Campylobacter jejuni subsp CDTB Protein

• Cat.No.: CDTB-39C
• Product Overview: Campylobacter jejuni subsp CDTB Protein was expressed in E. coli.

Specification

• Species: Campylobacter jejuni subsp
• Source: E.coli
• Description: cytolethal distending toxin B
• Form: The purified protein was Lyophilized from sterile 20 mM Tris-HCl buffer (pH 8.0) containing 0.2 M NaCl, 2 mM DTT. 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Molecular Mass: ~27.4kDa
• AA Sequence: MNLENFNVGTWNLQGSSAATESKWSVSVRQLVSGANPLDILMIQEAGTLPRTATPTGRHVQQGGTPIDEYEWNLGTLSRPDRVFIYYSRVDVGANRVNLAIVSRMQAEEVIVLPPPTTVSRPIIGIRNGNDAFFNIHALANGGTDVGAIITAVDAHFANMPQVNWMIAGDFNRDPSTITSTVDRELANRIRVVFPTSATQASGGTLDYAITGNSNRQQTYTPPLLAAILMLASLRSHIVSDHFPVNFRKFAS
• Purity: ＞90%
• Storage: Short-term storage: Store at 2-8 centigrade. Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Concentration: 1.0 mg/Vial

Gene Information

• Gene Name: cdtB cytolethal distending toxin B [ Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 ]
• Official Symbol: CDTB
• Gene ID: 904405
• Protein Refseq: YP_002343540
• UniProt ID: Q0PC57