Active Recombinant Dog IL5 Protein, His-tagged

Cat.No. : IL5-003D
Product Overview : Recombinant canine IL-5, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : Insect cells
Tag : His
Description : Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
Form : Liquid
Bio-activity : Measured in a cell proliferation assay using TF-1 human erythroleukemic cell. The ED50 range ≤ 15 ng/mL.
Molecular Mass : 13.9 kDa
AA Sequence : VENPMNRLVAETLTLLSTHRTWLIGDGNLMIPTPENKNHQLCIKEVFQGIDTLKNQTAHGEAVDKLFQNLSLIKEHIERQKKRCAGERWRVTKFLDYLQVFLGVINTEWTPES
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -82 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name IL5 interleukin 5 [ Canis lupus familiaris (dog) ]
Official Symbol IL5
Synonyms IL5; interleukin 5; interleukin-5; IL-5; T-cell replacing factor; TRF; eosinophil differentiation factor; interleukin 5 (colony-stimulating factor, eosinophil)
Gene ID 403790
mRNA Refseq NM_001006950
Protein Refseq NP_001006951
UniProt ID Q95J76

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL5 Products

Required fields are marked with *

My Review for All IL5 Products

Required fields are marked with *

0
cart-icon
0
compare icon