Recombinant Full Length Human BCCIP Protein, C-Flag-tagged

Cat.No. : BCCIP-344HFL
Product Overview : Recombinant Full Length Human BCCIP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene product was isolated on the basis of its interaction with BRCA2 and p21 proteins. It is an evolutionarily conserved nuclear protein with multiple interacting domains. The N-terminal half shares moderate homology with regions of calmodulin and M-calpain, suggesting that it may also bind calcium. Functional studies indicate that this protein may be an important cofactor for BRCA2 in tumor suppression, and a modulator of CDK2 kinase activity via p21. This protein has also been implicated in the regulation of BRCA2 and RAD51 nuclear focus formation, double-strand break-induced homologous recombination, and cell cycle progression. Multiple transcript variants encoding different isoforms have been described for this gene.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 35.8 kDa
AA Sequence : MASRSKRRAVESGVPQPPDPPVQRDEEEEKEVENEDEDDDDSDKEKDEEDEVIDEEVNIEFEAYSLSDND YDGIKKLLQQLFLKAPVNTAELTDLLIQQNHIGSVIKQTDVSEDSNDDMDEDEVFGFISLLNLTERKGTQ CVEQIQELVLRFCEKNCEKSMVEQLDKFLNDTTKPVGLLLSERFINVPPQIALPMYQQLQKELAGAHRTN KPCGKCYFYLLISKTFVEAEKNNSKKKPSNKKKAALMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKW
SFDDVPMTPLRTVMLIPGDKMNEIMDKLKEYLSVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Stem cell - Pluripotency
Full Length : Full L.
Gene Name BCCIP BRCA2 and CDKN1A interacting protein [ Homo sapiens (human) ]
Official Symbol BCCIP
Synonyms TOK1; TOK-1
Gene ID 56647
mRNA Refseq NM_078468.3
Protein Refseq NP_510868.1
MIM 611883
UniProt ID Q9P287

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BCCIP Products

Required fields are marked with *

My Review for All BCCIP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon