Recombinant Human BCCIP Protein, GST-tagged
| Cat.No. : | BCCIP-132H |
| Product Overview : | Human BCCIP partial ORF ( AAH09771, 210 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene product was isolated on the basis of its interaction with BRCA2 and p21 proteins. It is an evolutionarily conserved nuclear protein with multiple interacting domains. The N-terminal half shares moderate homology with regions of calmodulin and M-calpain, suggesting that it may also bind calcium. Functional studies indicate that this protein may be an important cofactor for BRCA2 in tumor suppression, and a modulator of CDK2 kinase activity via p21. This protein has also been implicated in the regulation of BRCA2 and RAD51 nuclear focus formation, double-strand break-induced homologous recombination, and cell cycle progression. Multiple transcript variants encoding different isoforms have been described for this gene. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.96 kDa |
| AA Sequence : | NKPCGKCYFYLLISKTFVEAEKNNSKKKPSNKKKAALMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKWSFDDVPMTPLRTVMLIPGDKMNEIMDKLKEYLSV |
| Purity : | Glutathione Sepharose 4 Fast Flow |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BCCIP BRCA2 and CDKN1A interacting protein [ Homo sapiens ] |
| Official Symbol | BCCIP |
| Synonyms | BCCIP; BRCA2 and CDKN1A interacting protein; BRCA2 and CDKN1A-interacting protein; BCCIPalpha; TOK 1; BCCIPbeta; TOK-1beta; TOK-1alpha; protein TOK-1; cdk inhibitor p21 binding protein; p21- and CDK-associated protein 1; BRCA2 and Cip1/p21 interacting protein; TOK1; TOK-1; |
| Gene ID | 56647 |
| mRNA Refseq | NM_016567 |
| Protein Refseq | NP_057651 |
| MIM | 611883 |
| UniProt ID | Q9P287 |
| ◆ Recombinant Proteins | ||
| BCCIP-4365H | Recombinant Human BCCIP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| BCCIP-434H | Recombinant Human BCCIP Protein, His (Fc)-Avi-tagged | +Inquiry |
| BCCIP-344HFL | Recombinant Full Length Human BCCIP Protein, C-Flag-tagged | +Inquiry |
| BCCIP-982M | Recombinant Mouse BCCIP Protein, His (Fc)-Avi-tagged | +Inquiry |
| BCCIP-131H | Recombinant Human BCCIP Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BCCIP-001HCL | Recombinant Human BCCIP cell lysate | +Inquiry |
| BCCIP-002HCL | Recombinant Human BCCIP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BCCIP Products
Required fields are marked with *
My Review for All BCCIP Products
Required fields are marked with *



