Recombinant Full Length Human CA12 Protein, C-Flag-tagged
Cat.No. : | CA12-2169HFL |
Product Overview : | Recombinant Full Length Human CA12 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Three transcript variants encoding different isoforms have been identified for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.8 kDa |
AA Sequence : | MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDAS LTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHF AAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEEL LPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKF DERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMET EAHA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Nitrogen metabolism |
Full Length : | Full L. |
Gene Name | CA12 carbonic anhydrase 12 [ Homo sapiens (human) ] |
Official Symbol | CA12 |
Synonyms | CAXII; CA-XII; T18816; HsT18816 |
Gene ID | 771 |
mRNA Refseq | NM_001218.5 |
Protein Refseq | NP_001209.1 |
MIM | 603263 |
UniProt ID | O43570 |
◆ Recombinant Proteins | ||
CA12-595R | Recombinant Rhesus monkey CA12 Protein, His-tagged | +Inquiry |
CA12-5357H | Recombinant Human CA12 protein, His-tagged | +Inquiry |
CA12-1456C | Recombinant Cynomolgus CA12 protein, His-tagged | +Inquiry |
CA12-7846H | Recombinant Human CA12 protein, His-tagged | +Inquiry |
CA12-3407H | Recombinant Human CA12 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA12-3067MCL | Recombinant Mouse CA12 cell lysate | +Inquiry |
CA12-3061HCL | Recombinant Human CA12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CA12 Products
Required fields are marked with *
My Review for All CA12 Products
Required fields are marked with *
0
Inquiry Basket