Expand| Cat.No. : | CA12-0233H |
| Product Overview : | Human CA12 full-length ORF (NP_001209.1, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal. |
| Description : | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Three transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jun 2014] |
| Source : | Wheat Germ |
| Species : | Human |
| Tag : | GST |
| Molecular Mass : | 65.9 kDa |
| AA Sequence : | MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Quality Control Testing : |
12.5% SDS-PAGE Stained with Coomassie Blue. |
| Gene Name : | CA12 carbonic anhydrase XII [ Homo sapiens ] |
| Official Symbol : | CA12 |
| Synonyms : | CA12; carbonic anhydrase XII; carbonic anhydrase 12; HsT18816; CA-XII; carbonic dehydratase; carbonate dehydratase XII; tumor antigen HOM-RCC-3.1.3; CAXII; FLJ20151; |
| Gene ID : | 771 |
| mRNA Refseq : | NM_001218 |
| Protein Refseq : | NP_001209 |
| MIM : | 603263 |
| UniProt ID : | O43570 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All CA12 Products
Download Datasheet