Recombinant Human CA12 Protein, GST-Tagged
Cat.No. : | CA12-0233H |
Product Overview : | Human CA12 full-length ORF (NP_001209.1, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. This gene product is a type I membrane protein that is highly expressed in normal tissues, such as kidney, colon and pancreas, and has been found to be overexpressed in 10% of clear cell renal carcinomas. Three transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jun 2014] |
Molecular Mass : | 65.9 kDa |
AA Sequence : | MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CA12 carbonic anhydrase XII [ Homo sapiens ] |
Official Symbol | CA12 |
Synonyms | CA12; carbonic anhydrase XII; carbonic anhydrase 12; HsT18816; CA-XII; carbonic dehydratase; carbonate dehydratase XII; tumor antigen HOM-RCC-3.1.3; CAXII; FLJ20151; |
Gene ID | 771 |
mRNA Refseq | NM_001218 |
Protein Refseq | NP_001209 |
MIM | 603263 |
UniProt ID | O43570 |
◆ Recombinant Proteins | ||
CAR12-2714M | Recombinant Mouse CAR12 Protein | +Inquiry |
CA12-7846H | Recombinant Human CA12 protein, His-tagged | +Inquiry |
CA12-0233H | Recombinant Human CA12 Protein, GST-Tagged | +Inquiry |
CA12-595R | Recombinant Rhesus monkey CA12 Protein, His-tagged | +Inquiry |
CA12-104H | Recombinant Human CA12, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CA12-3061HCL | Recombinant Human CA12 cell lysate | +Inquiry |
CA12-3067MCL | Recombinant Mouse CA12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA12 Products
Required fields are marked with *
My Review for All CA12 Products
Required fields are marked with *