Recombinant Full Length Human CLDN3 Protein
Cat.No. : | CLDN3-84HF |
Product Overview : | Recombinant full length Human Claudin 3 with an N terminal proprietary tag; Predicted MWt 50.31 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 220 amino acids |
Description : | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this intronless gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is also a low-affinity receptor for Clostridium perfringens enterotoxin, and shares aa sequence similarity with a putative apoptosis-related protein found in rat. |
Form : | Liquid |
Molecular Mass : | 50.310kDa inclusive of tags |
AA Sequence : | MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNII TSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR ALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMG AGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSA PRSTGPGASLGTGYDRKDYV |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CLDN3 claudin 3 [ Homo sapiens ] |
Official Symbol | CLDN3 |
Synonyms | CLDN3; claudin 3; C7orf1, CPETR2; claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE R2; CPE receptor 2; HRVP1; RVP1; ventral prostate.1 like protein |
Gene ID | 1365 |
mRNA Refseq | NM_001306 |
Protein Refseq | NP_001297 |
MIM | 602910 |
UniProt ID | O15551 |
◆ Recombinant Proteins | ||
RFL4935HF | Recombinant Full Length Human Claudin-3(Cldn3) Protein, His-Tagged | +Inquiry |
CLDN3-84HF | Recombinant Full Length Human CLDN3 Protein | +Inquiry |
CLDN3-5776C | Recombinant Chicken CLDN3 | +Inquiry |
CLDN3-721R | Recombinant Rhesus Macaque CLDN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDN3-11295H | Recombinant Human CLDN3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN3-7463HCL | Recombinant Human CLDN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN3 Products
Required fields are marked with *
My Review for All CLDN3 Products
Required fields are marked with *
0
Inquiry Basket