Recombinant Full Length Human CLDN4 Protein
Cat.No. : | CLDN4-87HF |
Product Overview : | Recombinant full length Human Claudin 4 with N terminal proprietary tag; Predicted MWt 48.73 kDa including the tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 48.730kDa inclusive of tags |
Protein Length : | 209 amino acids |
AA Sequence : | MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNI VTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAA RALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREM GASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAA RSAAASNYV |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | CLDN4 claudin 4 [ Homo sapiens ] |
Official Symbol : | CLDN4 |
Synonyms : | CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein |
Gene ID : | 1364 |
mRNA Refseq : | NM_001305 |
Protein Refseq : | NP_001296 |
MIM : | 602909 |
UniProt ID : | O14493 |
Products Types
◆ Recombinant Protein | ||
CLDN4-722R | Recombinant Rhesus Macaque CLDN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDN4-150H | Recombinant Human CLDN4 Protein, Myc/DDK-tagged | +Inquiry |
CLDN4-1443H | Recombinant Human CLDN4 Protein, GST-tagged | +Inquiry |
CLDN4-612H | Recombinant Human CLDN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDN4-1733M | Recombinant Mouse CLDN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
CLDN4-7462HCL | Recombinant Human CLDN4 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket