Recombinant Human CLDN4
Cat.No. : | CLDN4-27272TH |
Product Overview : | Recombinant full length Human Claudin 4 with N terminal proprietary tag; Predicted MWt 48.73 kDa including the tag. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. |
Protein length : | 209 amino acids |
Molecular Weight : | 48.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNI VTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAA RALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREM GASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAA RSAAASNYV |
Sequence Similarities : | Belongs to the claudin family. |
Gene Name : | CLDN4 claudin 4 [ Homo sapiens ] |
Official Symbol : | CLDN4 |
Synonyms : | CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein; |
Gene ID : | 1364 |
mRNA Refseq : | NM_001305 |
Protein Refseq : | NP_001296 |
MIM : | 602909 |
Uniprot ID : | O14493 |
Chromosome Location : | 7q11.23 |
Pathway : | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
Function : | identical protein binding; structural molecule activity; transmembrane signaling receptor activity; |
Products Types
◆ Recombinant Protein | ||
CLDN4-1443H | Recombinant Human CLDN4 Protein, GST-tagged | +Inquiry |
CLDN4-612H | Recombinant Human CLDN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDN4-1733M | Recombinant Mouse CLDN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDN4-150H | Recombinant Human CLDN4 Protein, Myc/DDK-tagged | +Inquiry |
Cldn4-901M | Recombinant Mouse Cldn4 Protein, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
CLDN4-7462HCL | Recombinant Human CLDN4 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket