Active Recombinant Human CLDN4 Full Length Transmembrane protein, His-tagged(VLPs)
Cat.No. : | CLDN4-11H |
Product Overview : | Recombinant Human CLDN4 Full Length protein(O14493)(1-209aa)(VLPs), fused with His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-209aa |
Form : | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 μg/mL can bind Anti-CLDN4 recombinant antibody, the EC50 is 29.56-50.75 ng/mL. |
Molecular Mass : | 23.4 kDa |
AA Sequence : | MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CLDN4 claudin 4 [ Homo sapiens ] |
Official Symbol | CLDN4 |
Synonyms | CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein; CPE-receptor; Williams-Beuren syndrome chromosomal region 8 protein; CPER; CPE-R; CPETR; CPETR1; hCPE-R; |
Gene ID | 1364 |
mRNA Refseq | NM_001305 |
Protein Refseq | NP_001296 |
MIM | 602909 |
UniProt ID | O14493 |
◆ Recombinant Proteins | ||
CLDN4-4751H | Recombinant Human CLDN4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CLDN4-3538M | Recombinant Mouse CLDN4 Protein | +Inquiry |
CLDN4-0392H | Active Recombinant Human CLDN4 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
CLDN4-1443H | Recombinant Human CLDN4 Protein, GST-tagged | +Inquiry |
CLDN4-896R | Recombinant Rhesus monkey CLDN4 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CLDN4-30H | Active Recombinant Full Length Human CLDN4 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN4-7462HCL | Recombinant Human CLDN4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN4 Products
Required fields are marked with *
My Review for All CLDN4 Products
Required fields are marked with *