Active Recombinant Human CLDN4 Full Length Transmembrane protein, His-tagged(VLPs)

• Cat.No.: CLDN4-11H
• Product Overview: Recombinant Human CLDN4 Full Length protein(O14493)(1-209aa)(VLPs), fused with His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 1-209aa
• Form: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Human CLDN4 at 5 μg/mL can bind Anti-CLDN4 recombinant antibody, the EC50 is 29.56-50.75 ng/mL.
• Molecular Mass: 23.4 kDa
• AA Sequence: MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CLDN4 claudin 4 [ Homo sapiens ]
• Official Symbol: CLDN4
• Synonyms: CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein; CPE-receptor; Williams-Beuren syndrome chromosomal region 8 protein; CPER; CPE-R; CPETR; CPETR1; hCPE-R
• Gene ID: 1364
• mRNA Refseq: NM_001305
• Protein Refseq: NP_001296
• MIM: 602909
• UniProt ID: O14493