Recombinant Full Length Human IL4I1 Protein, C-Flag-tagged
Cat.No. : | IL4I1-1563HFL |
Product Overview : | Recombinant Full Length Human IL4I1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a secreted L-amino acid oxidase protein which primarily catabolizes L-phenylalanine and, to a lesser extent, L-arginine. The expression of this gene is induced by the cytokine interleukin 4 in B cells. This gene is also expressed in macrophages and dendritic cells. This protein may play a role immune system escape as it is expressed in tumor-associated macrophages and suppresses T-cell responses. This protein also contains domains thought to be involved in the binding of flavin adenine dinucleotide (FAD) cofactor. Multiple transcript variants encoding different isoforms have been found for this gene. Some transcripts of this gene share a promoter and exons of the 5' UTR with the overlapping NUP62 gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 65.1 kDa |
AA Sequence : | MPNDDFCPGLTIKAMGAERAPQRQPCTLHLLVLVPILLSLVASQDWKAERSQDPFEKCMQDPDYEQLLKV VTWGLNRTLKPQRVIVVGAGVAGLVAAKVLSDAGHKVTILEADNRIGGRIFTYRDQNMGWIGELGAMRMP SSHRILHKLCQGLGLNLTKFTQYDKNTWTEVHEVKLRNYVVEKVPEKLGYALRPQEKGHSPEDIYQMALN QALKDLKALGCRKAMKKFERHTLLEYLLGEGNLSRPAVQLLGDVMSEDGFFYLSFAEALRAHSCLSDRLQ YSRIVGGWDLLPRALLSSLSGLVLLNAPVVAMTQGPHDVHVQIETSPPARNLKVLKADVVLLTASGPAVK RITFSPPLPRHMQEALRRLHYVPATKVFLSFRRPFWREEHIEGGHSNTDRPSRMIFYPPPREGALLLASY TWSDAAAAFAGLSREEALRLALDDVAALHGPVVRQLWDGTGVVKRWAEDQHSQGGFVVQPPALWQTEKDD WTVPYGRIYFAGEHTAYPHGWVETAVKSALRAAIKINSRKGPASDTASPEGHASDMEGQGHVHGVASSPS HDLAKEEGSHPPVQGQLSLQNTTHTRTSHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Alanine, aspartate and glutamate metabolism, Cysteine and methionine metabolism, Metabolic pathways, Phenylalanine, tyrosine and tryptophan biosynthesis, Phenylalanine metabolism, Tryptophan metabolism, Tyrosine metabolism, Valine, leucine and isoleucine degradation |
Full Length : | Full L. |
Gene Name | IL4I1 interleukin 4 induced 1 [ Homo sapiens (human) ] |
Official Symbol | IL4I1 |
Synonyms | LAO; FIG1; LAAO; hIL4I1 |
Gene ID | 259307 |
mRNA Refseq | NM_172374.3 |
Protein Refseq | NP_758962.1 |
MIM | 609742 |
UniProt ID | Q96RQ9 |
◆ Recombinant Proteins | ||
IL4I1-3716C | Recombinant Chicken IL4I1 | +Inquiry |
Il4i1-653M | Active Recombinant Mouse Interleukin 4 Induced 1, His-tagged | +Inquiry |
IL4I1-654H | Active Recombinant Human Interleukin 4 Induced 1, His-tagged | +Inquiry |
Il4i1-639M | Active Recombinant Mouse Il4i1 protein, His-tagged | +Inquiry |
IL4I1-1817H | Recombinant Human IL4I1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4I1-5225HCL | Recombinant Human IL4I1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL4I1 Products
Required fields are marked with *
My Review for All IL4I1 Products
Required fields are marked with *
0
Inquiry Basket