Recombinant Full Length Human ME1 Protein, C-Flag-tagged
Cat.No. : | ME1-782HFL |
Product Overview : | Recombinant Full Length Human ME1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 64 kDa |
AA Sequence : | MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFD RYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAW PEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIG LRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAG LLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQE KEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQC YKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVS DKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWP EEVQKIQTKVDQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Metabolic pathways, PPAR signaling pathway, Pyruvate metabolism |
Full Length : | Full L. |
Gene Name | ME1 malic enzyme 1 [ Homo sapiens (human) ] |
Official Symbol | ME1 |
Synonyms | MES; HUMNDME |
Gene ID | 4199 |
mRNA Refseq | NM_002395.6 |
Protein Refseq | NP_002386.1 |
MIM | 154250 |
UniProt ID | P48163 |
◆ Recombinant Proteins | ||
ME1-5947H | Recombinant Human ME1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ME1-1011HF | Recombinant Full Length Human ME1 Protein, GST-tagged | +Inquiry |
ME1-799H | Recombinant Human ME1 Protein, MYC/DDK-tagged | +Inquiry |
ME1-5876C | Recombinant Chicken ME1 | +Inquiry |
ME1-18H | Recombinant Human ME1 Protein, C-6×His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ME1-4401HCL | Recombinant Human ME1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ME1 Products
Required fields are marked with *
My Review for All ME1 Products
Required fields are marked with *
0
Inquiry Basket