Recombinant Human ME1 Protein, GST-tagged

Cat.No. : ME1-745H
Product Overview : Recombinant Human full length ME1 was expressed in wheat germ with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 88.66 kDa
AA Sequence : MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ
Storage : store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Full Length : Full L.
Gene Name ME1 malic enzyme 1, NADP(+)-dependent, cytosolic [ Homo sapiens ]
Official Symbol ME1
Synonyms ME1; malic enzyme 1, NADP(+)-dependent, cytosolic; NADP-dependent malic enzyme; NADP-ME; malate dehydrogenase; malic enzyme 1, soluble; Malic enzyme, cytoplasmic; pyruvic-malic carboxylase; MES; HUMNDME
Gene ID 4199
mRNA Refseq NM_002395
Protein Refseq NP_002386
MIM 154250
UniProt ID P48163

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ME1 Products

Required fields are marked with *

My Review for All ME1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon