Recombinant Human ME1 Protein, GST-tagged
Cat.No. : | ME1-745H |
Product Overview : | Recombinant Human full length ME1 was expressed in wheat germ with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 88.66 kDa |
AA Sequence : | MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ |
Storage : | store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Full Length : | Full L. |
Gene Name | ME1 malic enzyme 1, NADP(+)-dependent, cytosolic [ Homo sapiens ] |
Official Symbol | ME1 |
Synonyms | ME1; malic enzyme 1, NADP(+)-dependent, cytosolic; NADP-dependent malic enzyme; NADP-ME; malate dehydrogenase; malic enzyme 1, soluble; Malic enzyme, cytoplasmic; pyruvic-malic carboxylase; MES; HUMNDME |
Gene ID | 4199 |
mRNA Refseq | NM_002395 |
Protein Refseq | NP_002386 |
MIM | 154250 |
UniProt ID | P48163 |
◆ Recombinant Proteins | ||
ME1-745H | Recombinant Human ME1 Protein, GST-tagged | +Inquiry |
ME1-5876C | Recombinant Chicken ME1 | +Inquiry |
ME1-1011HF | Recombinant Full Length Human ME1 Protein, GST-tagged | +Inquiry |
ME1-1387H | Recombinant Human ME1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ME1-18H | Recombinant Human ME1 Protein, C-6×His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ME1-4401HCL | Recombinant Human ME1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ME1 Products
Required fields are marked with *
My Review for All ME1 Products
Required fields are marked with *