Recombinant Human ME1 Protein, C-6×His tagged
| Cat.No. : | ME1-18H |
| Product Overview : | Recombinant Human ME1 Protein with C-6×His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | Enables cytokine activity and growth factor activity. Acts upstream of or within several processes, including animal organ development; generation of neurons; and positive regulation of macromolecule metabolic process. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; cranium; early conceptus; and female reproductive system. Orthologous to human LIF (LIF interleukin 6 family cytokine). |
| Molecular Mass : | 65.2 KD |
| AA Sequence : | MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQLEHHHHHH |
| Purity : | > 95% by SDS-PAGE |
| Usage : | Protein binding assay, small molecule inhibitor screening, substrate of kinase, antigen, ELISA, Western blot, crystallization and co- crystallization studies. |
| Storage : | Upon delivery aliquot and store at -80 centigrade. Avoid multiple freeze-thaw cycles. The protein is stable for 12 months at -80 centigrade, for 2-4 weeks at 4 centigrade. |
| Storage Buffer : | 30 mM Tris pH 7.4; 500 mM NaCl; 10% glycerol; 3 mM MgCl2; 5 mM beta-mercaptoethanol; 1 mM PMSF; 1 mM Benzamidine |
| Reconstitution : | Clear solution in 30 mM Tris, pH7.4, 150 mM NaCl, 40% Glycerol, 5 mM DTT |
| Gene Name | ME1 malic enzyme 1, NADP(+)-dependent, cytosolic [ Homo sapiens (human) ] |
| Official Symbol | ME1 |
| Synonyms | ME1; malic enzyme 1, NADP(+)-dependent, cytosolic; NADP-dependent malic enzyme; NADP-ME; malate dehydrogenase; malic enzyme 1, soluble; Malic enzyme, cytoplasmic; pyruvic-malic carboxylase; MES; HUMNDME; |
| Gene ID | 4199 |
| mRNA Refseq | NM_002395 |
| Protein Refseq | NP_002386 |
| MIM | 154250 |
| UniProt ID | P48163 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ME1 Products
Required fields are marked with *
My Review for All ME1 Products
Required fields are marked with *
Recently Viewed
