Recombinant Human ME1 Protein, C-6×His tagged

Cat.No. : ME1-18H
Product Overview : Recombinant Human ME1 Protein with C-6×His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Enables cytokine activity and growth factor activity. Acts upstream of or within several processes, including animal organ development; generation of neurons; and positive regulation of macromolecule metabolic process. Located in extracellular space. Is expressed in several structures, including alimentary system; central nervous system; cranium; early conceptus; and female reproductive system. Orthologous to human LIF (LIF interleukin 6 family cytokine).
Molecular Mass : 65.2 KD
AA Sequence : MEPEAPRRRHTHQRGYLLTRNPHLNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKPRGLFITIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQGAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEEMKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFVRSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQLEHHHHHH
Purity : > 95% by SDS-PAGE
Usage : Protein binding assay, small molecule inhibitor screening, substrate of kinase, antigen, ELISA, Western blot, crystallization and co- crystallization studies.
Storage : Upon delivery aliquot and store at -80 centigrade. Avoid multiple freeze-thaw cycles. The protein is stable for 12 months at -80 centigrade, for 2-4 weeks at 4 centigrade.
Storage Buffer : 30 mM Tris pH 7.4; 500 mM NaCl; 10% glycerol; 3 mM MgCl2; 5 mM beta-mercaptoethanol; 1 mM PMSF; 1 mM Benzamidine
Reconstitution : Clear solution in 30 mM Tris, pH7.4, 150 mM NaCl, 40% Glycerol, 5 mM DTT
Gene Name ME1 malic enzyme 1, NADP(+)-dependent, cytosolic [ Homo sapiens (human) ]
Official Symbol ME1
Synonyms ME1; malic enzyme 1, NADP(+)-dependent, cytosolic; NADP-dependent malic enzyme; NADP-ME; malate dehydrogenase; malic enzyme 1, soluble; Malic enzyme, cytoplasmic; pyruvic-malic carboxylase; MES; HUMNDME;
Gene ID 4199
mRNA Refseq NM_002395
Protein Refseq NP_002386
MIM 154250
UniProt ID P48163

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ME1 Products

Required fields are marked with *

My Review for All ME1 Products

Required fields are marked with *

0
cart-icon