Recombinant Full Length Human PYCARD Protein, C-Flag-tagged
Cat.No. : | PYCARD-86HFL |
Product Overview : | Recombinant Full Length Human PYCARD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 21.4 kDa |
AA Sequence : | MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTA NVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKV LTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Cytosolic DNA-sensing pathway, NOD-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | PYCARD PYD and CARD domain containing [ Homo sapiens (human) ] |
Official Symbol | PYCARD |
Synonyms | ASC; TMS; TMS1; CARD5; TMS-1 |
Gene ID | 29108 |
mRNA Refseq | NM_013258.5 |
Protein Refseq | NP_037390.2 |
MIM | 606838 |
UniProt ID | Q9ULZ3 |
◆ Recombinant Proteins | ||
PYCARD-3718R | Recombinant Rhesus monkey PYCARD Protein, His-tagged | +Inquiry |
PYCARD-4939H | Recombinant Human PYCARD protein, His&Myc-tagged | +Inquiry |
PYCARD-12H | Recombinant Human PYCARD protein, His tagged | +Inquiry |
PYCARD-01H | Recombinant Human PYCARD Protein, Myc/DDK-tagged | +Inquiry |
Pycard-5433M | Recombinant Mouse Pycard protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PYCARD-2650HCL | Recombinant Human PYCARD 293 Cell Lysate | +Inquiry |
PYCARD-2648HCL | Recombinant Human PYCARD 293 Cell Lysate | +Inquiry |
PYCARD-2649HCL | Recombinant Human PYCARD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PYCARD Products
Required fields are marked with *
My Review for All PYCARD Products
Required fields are marked with *
0
Inquiry Basket