Recombinant Human PYCARD protein, His tagged
| Cat.No. : | PYCARD-12H |
| Product Overview : | Recombinant Human PYCARD protein with His tag was expressed in Baculovirus-Insect Cells. |
| Availability | November 06, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 113-195 aa |
| Description : | This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene. |
| Tag : | His |
| Molecular Mass : | 11 kDa |
| AA Sequence : | MHHHHHHHHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile 50mM Tris, pH8.0, 200mM NaCl, 50mM Arginine. |
| Concentration : | 0.26 mg/mL by BCA |
| Gene Name | PYCARD PYD and CARD domain containing [ Homo sapiens (human) ] |
| Official Symbol | PYCARD |
| Synonyms | PYCARD; PYD and CARD domain containing; apoptosis-associated speck-like protein containing a CARD; ASC; CARD5; TMS 1; target of methylation-induced silencing 1; caspase recruitment domain-containing protein 5; TMS; TMS1; TMS-1; MGC10332; |
| Gene ID | 29108 |
| mRNA Refseq | NM_013258 |
| Protein Refseq | NP_037390 |
| MIM | 606838 |
| UniProt ID | Q9ULZ3 |
| ◆ Recombinant Proteins | ||
| PYCARD-1814H | Recombinant Human PYCARD Protein, His (Fc)-Avi-tagged | +Inquiry |
| PYCARD-3266H | Recombinant Human PYCARD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PYCARD-9047Z | Recombinant Zebrafish PYCARD | +Inquiry |
| PYCARD-6130H | Recombinant Human PYCARD protein(1-93aa), His-tagged | +Inquiry |
| PYCARD-415HF | Recombinant Full Length Human PYCARD Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PYCARD-2649HCL | Recombinant Human PYCARD 293 Cell Lysate | +Inquiry |
| PYCARD-2650HCL | Recombinant Human PYCARD 293 Cell Lysate | +Inquiry |
| PYCARD-2648HCL | Recombinant Human PYCARD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PYCARD Products
Required fields are marked with *
My Review for All PYCARD Products
Required fields are marked with *
