Recombinant Human PYCARD protein, His tagged

Cat.No. : PYCARD-12H
Product Overview : Recombinant Human PYCARD protein with His tag was expressed in Baculovirus-Insect Cells.
Availability September 16, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 113-195 aa
Description : This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene.
Tag : His
Molecular Mass : 11 kDa
AA Sequence : MHHHHHHHHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile 50mM Tris, pH8.0, 200mM NaCl, 50mM Arginine.
Concentration : 0.26 mg/mL by BCA
Gene Name PYCARD PYD and CARD domain containing [ Homo sapiens (human) ]
Official Symbol PYCARD
Synonyms PYCARD; PYD and CARD domain containing; apoptosis-associated speck-like protein containing a CARD; ASC; CARD5; TMS 1; target of methylation-induced silencing 1; caspase recruitment domain-containing protein 5; TMS; TMS1; TMS-1; MGC10332;
Gene ID 29108
mRNA Refseq NM_013258
Protein Refseq NP_037390
MIM 606838
UniProt ID Q9ULZ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PYCARD Products

Required fields are marked with *

My Review for All PYCARD Products

Required fields are marked with *

0
cart-icon