Recombinant Human PYCARD, GST-tagged

Cat.No. : PYCARD-29108H
Product Overview : Human PYCARD full-length ORF ( AAH13569.2, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 42.13 kDa
AA Sequence : MDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAA LIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFNFTPAWNWTCKDLLLQALRESQSYLVEDLERS
Applications : Enzyme-linked Immunoabsorbent Assay, Western Blot, Antibody Production, Protein Array.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name PYCARD PYD and CARD domain containing [ Homo sapiens (human) ]
Official Symbol PYCARD
Synonyms ASC; TMS; TMS1; CARD5; TMS-1
Gene ID 29108
Protein Refseq AAH13569.2
MIM 606838
Chromosome Location 16p11.2
Pathway Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Influenza A, organism-specific biosystem
Function Pyrin domain binding; ion channel binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PYCARD Products

Required fields are marked with *

My Review for All PYCARD Products

Required fields are marked with *

0
cart-icon
0
compare icon