Recombinant Human PYCARD, GST-tagged
Cat.No. : | PYCARD-29108H |
Product Overview : | Human PYCARD full-length ORF ( AAH13569.2, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 42.13 kDa |
AA Sequence : | MDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAA LIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFNFTPAWNWTCKDLLLQALRESQSYLVEDLERS |
Applications : | Enzyme-linked Immunoabsorbent Assay, Western Blot, Antibody Production, Protein Array. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PYCARD PYD and CARD domain containing [ Homo sapiens (human) ] |
Official Symbol | PYCARD |
Synonyms | ASC; TMS; TMS1; CARD5; TMS-1 |
Gene ID | 29108 |
Protein Refseq | AAH13569.2 |
MIM | 606838 |
Chromosome Location | 16p11.2 |
Pathway | Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Influenza A, organism-specific biosystem |
Function | Pyrin domain binding; ion channel binding |
◆ Recombinant Proteins | ||
PYCARD-3718R | Recombinant Rhesus monkey PYCARD Protein, His-tagged | +Inquiry |
PYCARD-8966M | Recombinant Mouse PYCARD protein, His-tagged | +Inquiry |
PYCARD-86HFL | Recombinant Full Length Human PYCARD Protein, C-Flag-tagged | +Inquiry |
PYCARD-1814H | Recombinant Human PYCARD Protein, His (Fc)-Avi-tagged | +Inquiry |
PYCARD-4939H | Recombinant Human PYCARD protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PYCARD-2650HCL | Recombinant Human PYCARD 293 Cell Lysate | +Inquiry |
PYCARD-2648HCL | Recombinant Human PYCARD 293 Cell Lysate | +Inquiry |
PYCARD-2649HCL | Recombinant Human PYCARD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PYCARD Products
Required fields are marked with *
My Review for All PYCARD Products
Required fields are marked with *
0
Inquiry Basket