Recombinant human Activin B, Active, His-tagged
Cat.No. : | INHBB-1546H |
Product Overview : | Recombinant human Activin B is a polypeptide chain containing 123 amino acids (293- 406 P09529 INHBB_HUMAN) and a His-tag at the N-terminal end. It has a predicted molecular mass of 14 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Nicotiana Benthamiana |
Tag : | His |
Description : | Activins are homodimers or heterodimers of the various β subunit isoforms, belonging to the TGF-beta family. Mature Activin B has two chains of 123 amino acids residues (betaB-betaB). Activin exhibits a wide range of biological activities, including mesoderm induction, neural cell differentiation, bone remodelling, haematopoiesis, and reproductive physiology. Activins plays a key role in the production and regulation of hormones such as FSH, LH, GnRH and ACTH. Inhibins/Activins are protein that are formed by the dimerization of two subunits, i. e. an α (alpha) with either beta A (βA) - Inhibin A or beta B (βB) - Inhibin B. The subunits betaA and betaB can also form homodimers or heterodimers called Activin: Activin A (betaA -betaA), Activin B (betaB -betaB) and Activin AB (betaA -betaB). The Activin gene family comprises the additional, but poorly characterized members" Activin betaC (βC), beta D (βD) and beta E (βE). As with other members of the super-family, Activins interact with two types of cell surface trans-membrane receptors (Types I and II) which have intrinsic serine/threonine kinase activities in their cytoplasmic domains, Activin type 1 receptors, ACVR1, ACVR1B, ACVR1C and Activin type 2 receptors, ACVR2A, ACVR2B. |
Form : | Recombinant human Activin B is lyophilized from Tris HCl 0.05M buffer at pH 7.4. |
Molecular Mass : | 14 kDa |
AA Sequence : | HHHHHHHHHHGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQ YRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA |
Endotoxin : | < 0.04="" eu/μg="" protein="" (lal=""> |
Purity : | >97% by SDS-PAGE gel |
Storage : | This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended. |
Reconstitution : | Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Due to the protein nature, dimmers and multimers may be observed. Optimal concentration should be determined for specific application and cell lines. |
Gene Name | INHBB inhibin, beta B [ Homo sapiens ] |
Official Symbol | INHBB |
Synonyms | INHBB; inhibin, beta B; inhibin, beta B (activin AB beta polypeptide); inhibin beta B chain; Inhibin, beta-2; activin beta-B chain; activin AB beta polypeptide; MGC157939; |
Gene ID | 3625 |
mRNA Refseq | NM_002193 |
Protein Refseq | NP_002184 |
MIM | 147390 |
UniProt ID | P09529 |
Chromosome Location | 2cen-q13 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Glycoprotein hormones, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Peptide hormone biosynthesis, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; |
Function | cytokine activity; growth factor activity; hormone activity; host cell surface receptor binding; protein binding; protein homodimerization activity; |
◆ Recombinant Proteins | ||
INHBB-1546H | Recombinant human Activin B, Active, His-tagged | +Inquiry |
INHBB-1545H | Recombinant human Activin B | +Inquiry |
INHBB-5118H | Recombinant Human INHBB Protein, GST-tagged | +Inquiry |
INHBB-6759C | Recombinant Chicken INHBB | +Inquiry |
INHBB-8214M | Recombinant Mouse INHBB Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
INHBB-2612HCL | Recombinant Human INHBB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INHBB Products
Required fields are marked with *
My Review for All INHBB Products
Required fields are marked with *
0
Inquiry Basket