Recombinant human Activin B, Active, His-tagged

Cat.No. : INHBB-1546H
Product Overview : Recombinant human Activin B is a polypeptide chain containing 123 amino acids (293- 406 P09529 INHBB_HUMAN) and a His-tag at the N-terminal end. It has a predicted molecular mass of 14 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Nicotiana Benthamiana
Tag : His
Description : Activins are homodimers or heterodimers of the various β subunit isoforms, belonging to the TGF-beta family. Mature Activin B has two chains of 123 amino acids residues (betaB-betaB). Activin exhibits a wide range of biological activities, including mesoderm induction, neural cell differentiation, bone remodelling, haematopoiesis, and reproductive physiology. Activins plays a key role in the production and regulation of hormones such as FSH, LH, GnRH and ACTH. Inhibins/Activins are protein that are formed by the dimerization of two subunits, i. e. an α (alpha) with either beta A (βA) - Inhibin A or beta B (βB) - Inhibin B. The subunits betaA and betaB can also form homodimers or heterodimers called Activin: Activin A (betaA -betaA), Activin B (betaB -betaB) and Activin AB (betaA -betaB). The Activin gene family comprises the additional, but poorly characterized members" Activin betaC (βC), beta D (βD) and beta E (βE). As with other members of the super-family, Activins interact with two types of cell surface trans-membrane receptors (Types I and II) which have intrinsic serine/threonine kinase activities in their cytoplasmic domains, Activin type 1 receptors, ACVR1, ACVR1B, ACVR1C and Activin type 2 receptors, ACVR2A, ACVR2B.
Form : Recombinant human Activin B is lyophilized from Tris HCl 0.05M buffer at pH 7.4.
Molecular Mass : 14 kDa
AA Sequence : HHHHHHHHHHGLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQ YRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
Endotoxin : < 0.04="" eu/μg="" protein="" (lal="">
Purity : >97% by SDS-PAGE gel
Storage : This lyophilized preparation is stable at 2-8o C for short term, long storage it should be kept at -20oC. Reconstituted protein should be stored in working aliquots at –20°C. Repeated freezing and thawing is not recommended.
Reconstitution : Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Due to the protein nature, dimmers and multimers may be observed. Optimal concentration should be determined for specific application and cell lines.
Gene Name INHBB inhibin, beta B [ Homo sapiens ]
Official Symbol INHBB
Synonyms INHBB; inhibin, beta B; inhibin, beta B (activin AB beta polypeptide); inhibin beta B chain; Inhibin, beta-2; activin beta-B chain; activin AB beta polypeptide; MGC157939;
Gene ID 3625
mRNA Refseq NM_002193
Protein Refseq NP_002184
MIM 147390
UniProt ID P09529
Chromosome Location 2cen-q13
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Glycoprotein hormones, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Peptide hormone biosynthesis, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem;
Function cytokine activity; growth factor activity; hormone activity; host cell surface receptor binding; protein binding; protein homodimerization activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INHBB Products

Required fields are marked with *

My Review for All INHBB Products

Required fields are marked with *

0
cart-icon