Recombinant Human AIMP1 protein

Cat.No. : AIMP1-87H
Product Overview : Recombinant Human AIMP1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 166
Description : Endothelial-Monocyte Activating Polypeptide II (EMAP-II) is a tumor derived cytokine that exerts a wide range of activities on endothelial cells, monocytes and neutrophils. EMAP-II inhibits endothelial cell proliferation, vasculogenesis, neovessel formation, and can induce apoptosis. It is also chemotactic towards neutrophils and monocytes and induces myeloperoxidase activity from neutrophils. Of clinical importance, EMAP-II inhibits angiogenesis of vascular beds and suppresses the growth of primary and secondary tumors without affecting normal tissues. Mature EMAP-II is an 18.3 kDa protein, which is synthesized as the C-terminal portion of a biologically inactive precursor protein containing a propeptide of 146 amino acid residues.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by the apoptotic effect using serum free human MCF-7 cells is less than 40 ng/ml, corresponding to a specific activity of > 2.5 × 10⁴ IU/mg.
Molecular Mass : Approximately 18.2 kDa, a single non-glycosylated polypeptide chain containing 166 amino acids.
AA Sequence : SKPIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK
Endotoxin : Less than 1 EU/μg of rHuEMAP-II as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name AIMP1
Official Symbol AIMP1
Synonyms AIMP1; aminoacyl tRNA synthetase complex-interacting multifunctional protein 1; SCYE1, small inducible cytokine subfamily E, member 1 (endothelial monocyte activating); aminoacyl tRNA synthase complex-interacting multifunctional protein 1; ARS interacting multifunctional protein 1; EMAP II; EMAP 2; EMAPII; p43; ARS-interacting multifunctional protein 1; endothelial monocyte-activating polypeptide 2; multisynthase complex auxiliary component p43; endothelial-monocyte activating polypeptide II; multisynthetase complex auxiliary component p43; small inducible cytokine subfamily E, member 1 (endothelial monocyte-activating); HLD3; EMAP2; SCYE1;
Gene ID 9255
mRNA Refseq NM_001142415
Protein Refseq NP_001135887
MIM 603605
UniProt ID Q12904

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AIMP1 Products

Required fields are marked with *

My Review for All AIMP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon