Recombinant Human AKR1C2 Protein, GST-tagged
Cat.No. : | AKR1C2-412H |
Product Overview : | Human AKR1C2 full-length ORF ( AAH07024, 1 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols using NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme binds bile acid with high affinity, and shows minimal 3-alpha-hydroxysteroid dehydrogenase activity. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Dec 2011] |
Molecular Mass : | 61.16 kDa |
AA Sequence : | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AKR1C2 aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III) [ Homo sapiens ] |
Official Symbol | AKR1C2 |
Synonyms | AKR1C2; aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III); DDH2; aldo-keto reductase family 1 member C2; BABP; DD; DD2; HAKRD; MCDR2; DD-2; DD/BABP; 3-alpha-HSD3; pseudo-chlordecone reductase; type II dihydrodiol dehydrogenase; chlordecone reductase homolog HAKRD; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; HBAB; SRXY8; AKR1C-pseudo; FLJ53800; |
Gene ID | 1646 |
mRNA Refseq | NM_001135241 |
Protein Refseq | NP_001128713 |
MIM | 600450 |
UniProt ID | P52895 |
◆ Recombinant Proteins | ||
AKR1C2-18H | Recombinant Human AKR1C2, MYC/DDK-tagged | +Inquiry |
AKR1C2-0452H | Recombinant Human AKR1C2 Protein (Met1-Tyr323 ), Tag Free | +Inquiry |
AKR1C2-27159TH | Recombinant Human AKR1C2 | +Inquiry |
AKR1C2-1367HF | Recombinant Full Length Human AKR1C2 Protein, GST-tagged | +Inquiry |
AKR1C2-898H | Recombinant Human AKR1C2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR1C2-8930HCL | Recombinant Human AKR1C2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKR1C2 Products
Required fields are marked with *
My Review for All AKR1C2 Products
Required fields are marked with *
0
Inquiry Basket